Germany
Japan
United Kingdom
China
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR094F2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Smad2/3 (Thr8) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Smad2/3 around the phosphorylation site of Threonine 8 |
| Modifications | Phospho-specific |
Goat Polyclonal Antibody against DKK1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CDHHQASNSSRLHT, from the C Terminus of the protein sequence according to NP_036374. |
Rabbit Polyclonal Antibody against NANOG (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NANOG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 15-49 amino acids from the N-terminal region of human NANOG. |
Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA |
Rabbit Polyclonal CD44 (Ser706) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CD44 around the phosphorylation site of Serine 706 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-WNT3A Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT3A antibody: synthetic peptide directed towards the N terminal of human WNT3A. Synthetic peptide located within the following region: MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP |
Rabbit Polyclonal Anti-BMP6 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BMP6 antibody: synthetic peptide directed towards the N terminal of human BMP6. Synthetic peptide located within the following region: DGGSPGRTEQPPPSPQSSSGFLYRRLKTQEKREMQKEILSVLGLPHRPRP |
Rabbit Polyclonal Antibody against SOX2 - Embryonic Stem Cell Marker
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Sheep |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human SOX2 protein (within residues 1-100). [Swiss-Prot# P48431] |
Rabbit polyclonal SMAD3-S208 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SMAD3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from human SMAD3. |
Rabbit Polyclonal Anti-DKK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DKK1 antibody: synthetic peptide directed towards the C terminal of human DKK1. Synthetic peptide located within the following region: CARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKD |
Rabbit Polyclonal Antibody against SOX2 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SOX2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 89-119 amino acids from the N-terminal region of human SOX2. |
Rabbit polyclonal anti-Gli-3 antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Chimpanzee, Squirrel Monkey, Xenopus, Chicken, Dog |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was produced from monospecific rabbit serum by repeated immunizations with a synthetic peptide corresponding to amino acids 41-57 of human Gli-3 protein. |
Mouse Anti-Human CD34 Purified (100 ug)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-WNT5A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT5A antibody: synthetic peptide directed towards the middle region of human WNT5A. Synthetic peptide located within the following region: GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT |
Rabbit Polyclonal Anti-DKK2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DKK2 |
Rabbit Polyclonal Antibody against NANOG (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NANOG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 94-123 amino acids from the Central region of human NANOG. |
Rabbit polyclonal CD38 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD38 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 241-270 amino acids from the C-terminal region of human CD38. |
Rabbit Polyclonal Anti-WNT8B Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT8B antibody: synthetic peptide directed towards the N terminal of human WNT8B. Synthetic peptide located within the following region: QLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNG |
Rabbit Polyclonal Antibody against WIF1 (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This WIF1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 51-80 amino acids from the N-terminal region of human WIF1. |
Rabbit polyclonal CD44 (Ser706) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CD44 around the phosphorylation site of serine 706 (S-K-SP-Q-E). |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Thr693) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human: Thr693, Mouse: Thr695, Rat: Thr694 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of threonine 693 (P-L-TP-P-S). |
| Modifications | Phospho-specific |
Rabbit polyclonal Smad1 (Ser465) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Smad1 around the phosphorylation site of serine 465 (I-S-S-V-SP) |
| Modifications | Phospho-specific |
Rabbit polyclonal Smad1 (Ser187) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Smad1 around the phosphorylation site of serine 187 (P-H-SP-P-N). |
| Modifications | Phospho-specific |
Rabbit polyclonal Smad1 (Ab-465) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Smad1 around the phosphorylation site of serine 465 (I-S-S-V-SP). |
Active filters
Conjugates
- Unconjugated
Families
- Cancer stem cells
Filter by
Category
Target Symbol
- EGFR (122)
- GLI1 (93)
- CD44 (81)
- SMAD1 (40)
- CD34 (31)
- HES1 (29)
- SMAD2 (23)
- CD38 (21)
- NOTCH1 (20)
- POU5F1 (20)
- SMAD3 (20)
- SOX2 (20)
- BMP6 (16)
- NANOG (15)
- BMP4 (14)
- GLI2 (14)
- WNT1 (8)
- DLL4 (7)
- SMAD5 (6)
- WNT3A (6)
- WNT8B (6)
- DKK1 (5)
- DKK2 (5)
- SMAD6 (5)
- BMP2 (4)
- NODAL (4)
- SFRP1 (4)
- WIF1 (4)
- WNT2 (4)
- WNT5A (4)
- WNT6 (4)
- WNT8A (4)
- BMP15 (3)
- BMP5 (3)
- BMP7 (3)
- DKK4 (3)
- DLL3 (3)
- GDF3 (3)
- GLI3 (3)
- BMP8B (2)
- DLL1 (2)
- GDF7 (2)
- GDF5 (1)
- GDF9 (1)
- SFRP4 (1)
- WNT7B (1)
Reactivities
- Human (685)
- Mouse (462)
- Rat (402)
- Dog (31)
- Monkey (20)
- Bovine (13)
- Chicken (11)
- Pig (9)
- Primate (7)
- Zebrafish (6)
- Xenopus (5)
- Bat (4)
- Cow (4)
- Horse (4)
- Gibbon (3)
- Gorilla (3)
- Rabbit (3)
- Sheep (3)
- Canine (2)
- Chimpanzee (2)
- Hamster (2)
- X. tropicalis (2)
- Canis (1)
- Drosophila (1)
- Feline (1)
- Fish (1)
- Goat (1)
- Guinea Pig (1)
- Macaque (1)
- Opossum (1)
- Porcine (1)
- Quail (1)
Applications
Antibody Hosts
Clonalities
Knockout (KO) Validation
Modifications
Pathways
- Pathways in cancer (330)
- Hedgehog signaling pathway (189)
- Adherens junction (165)
- Basal cell carcinoma (165)
- Colorectal cancer (165)
- Pancreatic cancer (165)
- Calcium signaling pathway (143)
- TGF-beta signaling pathway (143)
- Dorso-ventral axis formation (142)
- Hematopoietic cell lineage (137)
- Cytokine-cytokine receptor interaction (130)
- Endocytosis (126)
- Bladder cancer (122)
- Endometrial cancer (122)
- Epithelial cell signaling in Helicobacter pylori infection (122)
- ErbB signaling pathway (122)
- Focal adhesion (122)
- Gap junction (122)
- Glioma (122)
- GnRH signaling pathway (122)
- MAPK signaling pathway (122)
- Melanoma (122)
- Non-small cell lung cancer (122)
- Prostate cancer (122)
- Regulation of actin cytoskeleton (122)
- Wnt signaling pathway (102)
- ECM-receptor interaction (81)
- Notch signaling pathway (61)
- Cell cycle (43)
- Melanogenesis (41)
- Cell adhesion molecules (CAMs) (31)
- Maturity onset diabetes of the young (29)
- Metabolic pathways (21)
- Nicotinate and nicotinamide metabolism (21)
- Chronic myeloid leukemia (20)
- Prion diseases (20)
- Acute myeloid leukemia (4)