Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Anti-CDH1 (aa662-675) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CDH1 (aa662-675) Antibody: Peptide with sequence C-DYKINLKLMDNQNK, from the internal region of the protein sequence according to NP_004351.1. |
Goat Polyclonal Anti-CDH1 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified Recombinant peptide derived from within residues 601 to 701 of human CDH1 produced in E. coli. |
Rabbit Polyclonal CLDN1 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | CLDN1 antibody was raised against a 20 amino acid synthetic peptide near the carboxy terminus of human CLDN1. The immunogen is located within the last 50 amino acids of CLDN1. |
Rabbit Polyclonal Antibody against CD14 (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD14 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 292-322 amino acids from the C-terminal region of human CD14. |
Mouse Anti-Human CD284 (TLR4) Purified (25 ug)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Goat Polyclonal Anti-CDH1 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 750 to 850 of human CDH1 produced in E. coli. |
Rabbit Polyclonal Antibody against CD14 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD14 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 54-83 amino acids from the N-terminal region of human CD14. |
Rabbit polyclonal Integrin beta1 (Thr789) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Integrin β1 around the phosphorylation site of threonine 789 (V-T-TP-V-V). |
| Modifications | Phospho-specific |
Rabbit Anti-Human TLR5 Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | TLR5 antibody was raised against synthetic peptide from human TLR5. |
CLDN1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CLDN1 |
Rabbit Polyclonal Anti-Claudin 1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Claudin 1 Antibody: A synthesized peptide derived from human Claudin 1 |
Rabbit Polyclonal Anti-E-cadherin Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-E-cadherin Antibody: A synthesized peptide derived from human E-cadherin |
Rabbit Polyclonal Anti-Integrin β1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Integrin β1 Antibody: A synthesized peptide derived from human Integrin β1 |
Rabbit polyclonal Integrin beta1 (Ab-789) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Integrin β1 around the phosphorylation site of threonine 789 (V-T-TP-V-V). |
Rabbit polyclonal Claudin 1 (Ab-210) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Claudin 1 around the phosphorylation site of tyrosine 210 (G-K-D-YP-V). |
Rabbit Polyclonal TLR4 antibody
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human TLR4 |
Rabbit Polyclonal TLR5 Antibody
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Rat, Porcine |
| Conjugation | Unconjugated |
| Immunogen | This antibody was developed against KLH-conjugated synthetic peptide corresponding to a portion of human TLR5 found between amino acids 300-350. It will cross-react with mouse and rat TLR5. |
Rabbit Polyclonal E-Cadherin Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal E-Cadherin Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal E-Cadherin Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal Antibody against CDH1 (N-term)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This E Cadherin (CDH1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 160-189 amino acids from the N-terminal region of human E Cadherin (CDH1). |
Rabbit Polyclonal Antibody against CDH1 (C-term)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This E Cadherin (CDH1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 833-862 amino acids from the C-terminal region of human E Cadherin (CDH1). |
Rabbit Polyclonal TLR5 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | TLR5 antibody was raised against a peptide corresponding to 15 amino acids near the carboxy terminus of human TLR5. The immunogen is located within the last 50 amino acids of TLR5. |
Rabbit polyclonal ITGB1 (Tyr795) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ITGB1 around the phosphorylation site of tyrosine 795 (P-K-YP-E-G). |
| Modifications | Phospho-specific |
Mouse Anti-Human CD29 (Integrin beta 1) Purified (100 ug)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal CDH1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CLDN1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLDN1 antibody: synthetic peptide directed towards the C terminal of human CLDN1. Synthetic peptide located within the following region: GQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV |
Goat Polyclonal Antibody against CD14
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KRVDADADPRQYAD, from the internal region of the protein sequence according to NP_000582.1. |
Rabbit polyclonal anti-TLR4 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to residues surrounding amino acids 819 of rat TLR4 |
Rabbit Polyclonal TLR4 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | TLR4 antibody was raised against a 14 amino acid synthetic peptide near the carboxy terminus of human TLR4. |
Mouse Anti-Human CD14 Purified (100 ug)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal CDH1 Antibody(Ascites)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 450.00
5 Days
Mouse monoclonal anti-ITGB1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal anti-TLR5 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TLR5 antibody: synthetic peptide directed towards the N terminal of human TLR5. Synthetic peptide located within the following region: QLQLLELGSQYTPLTIDKEAFRNLPNLRILDLGSSKIYFLHPDAFQGLFH |
Active filters
Conjugates
- Unconjugated
Families
- Transmembrane
Pathways
- Pathogenic Escherichia coli infection