Antibodies

View as table Download

Rabbit Polyclonal Anti-G6PC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM

HK1 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HK1

Rabbit polyclonal HK2 (Hexokinase II) Antibody (Center)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HK2 (Hexokinase II) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 453-483 amino acids from the Central region of human HK2 (Hexokinase II).

Rabbit Polyclonal antibody to PFK (muscle) (phosphofructokinase, muscle)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 253 of PFK (muscle) (Uniprot ID#P08237)

Rabbit polyclonal antibody to beta-Gal (galactosidase, beta 1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 166 and 677 of beta-Gal (Uniprot ID#P16278)

Rabbit anti-HK2 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HK2

Rabbit polyclonal anti-HK1 (HXK1) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human HXK1.

Rabbit Polyclonal Anti-G6pc Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-G6pc antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DFGIQSTRYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLKETVGI

Rabbit anti-GLB1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GLB1

Rabbit Polyclonal antibody to PFKL (phosphofructokinase, liver)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 428 and 674 of PFKL (Uniprot ID#P17858)

Rabbit polyclonal anti-B4GALT1 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human B4GALT1.

AKR1B1 Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human AKR1B1

Rabbit anti-PFKM Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PFKM

Rabbit Polyclonal Anti-GALT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GALT antibody: synthetic peptide directed towards the C terminal of human GALT. Synthetic peptide located within the following region: LLRSATVRKFMVGYEMLAQAQRDLTPEQAAERLRALPEVHYHLGQKDRET

Rabbit Polyclonal Anti-Hexokinase 1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Hexokinase 1 antibody was raised against a 16 amino acid peptide near the carboxy terminus of human Hexokinase 1.

Rabbit polyclonal AKR1B1 Antibody (C-term)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This AKR1B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 290-316 amino acids from the C-terminal region of human AKR1B1.

Rabbit polyclonal GCK Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This GCK antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human GCK.

Rabbit Polyclonal Anti-GAA Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GAA antibody: synthetic peptide directed towards the N terminal of human GAA. Synthetic peptide located within the following region: FGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPL

Rabbit Polyclonal Anti-AKR1B1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-AKR1B1 antibody: synthetic peptide directed towards the N terminal of human AKR1B1. Synthetic peptide located within the following region: ASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQN

Rabbit Polyclonal Anti-AKR1B1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-AKR1B1 antibody: synthetic peptide directed towards the C terminal of human AKR1B1. Synthetic peptide located within the following region: QSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLI

Rabbit Polyclonal Anti-UGP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGP2 antibody: synthetic peptide directed towards the N terminal of human UGP2. Synthetic peptide located within the following region: TKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDN

Rabbit Polyclonal Anti-GALK1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GALK1 Antibody: A synthesized peptide derived from human GALK1

Rabbit polyclonal anti-K6PP / PFKP antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human K6PP.

Rabbit polyclonal anti-K6PL antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human K6PL.

Rabbit polyclonal anti-AKR1B1 antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human AKR1B1.

Rabbit polyclonal anti-GALK1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human GALK1.

Rabbit polyclonal PFKL Antibody (C-term L684)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This PFKL antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 669-699 amino acids from the C-terminal region of human PFKL.

Rabbit Polyclonal Anti-GLA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GLA Antibody: synthetic peptide directed towards the N terminal of human GLA. Synthetic peptide located within the following region: PQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTF

Rabbit polyclonal anti-GLB1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GLB1.

Rabbit polyclonal HK2 (Hexokinase II) Antibody (N-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HK2 (Hexokinase II) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 91-121 amino acids from the N-terminal region of human HK2 (Hexokinase II).

Rabbit Polyclonal Anti-HK2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HK2 Antibody: synthetic peptide directed towards the N terminal of human HK2. Synthetic peptide located within the following region: GTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMRGSG

Rabbit polyclonal Hexokinase-3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Hexokinase-3.

Rabbit Polyclonal Anti-GALK2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GALK2 antibody is: synthetic peptide directed towards the C-terminal region of Human GALK2. Synthetic peptide located within the following region: TVSMVPADKLPSFLANVHKAYYQRSDGSLAPEKQSLFATKPGGGALVLLE

Rabbit Polyclonal Anti-GANC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GANC Antibody: synthetic peptide directed towards the middle region of human GANC. Synthetic peptide located within the following region: VLGFRKEPSSVTTHSSDGKDQPVAFTYCAKTSILSLEKLSLNIATDWEVR

Rabbit Polyclonal Anti-GALE Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GALE antibody: synthetic peptide directed towards the N terminal of human GALE. Synthetic peptide located within the following region: AEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRR

Rabbit Polyclonal Anti-GALE Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GALE antibody: synthetic peptide directed towards the middle region of human GALE. Synthetic peptide located within the following region: PQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKG

Rabbit Polyclonal Anti-B4GALT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-B4GALT2 Antibody: synthetic peptide directed towards the middle region of human B4GALT2. Synthetic peptide located within the following region: RLLIEFTSPMPLERVQRENPGVLMGGRYTPPDCTPAQTVAVIIPFRHREH

Rabbit Polyclonal Anti-B4GALT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-B4GALT2 Antibody: synthetic peptide directed towards the middle region of human B4GALT2. Synthetic peptide located within the following region: AGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPD

Rabbit Polyclonal Anti-B4GALT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-B4GALT2 Antibody: synthetic peptide directed towards the middle region of human B4GALT2. Synthetic peptide located within the following region: NRISLTGMKISRPDIRIGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKR

Rabbit Polyclonal Anti-HK2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HK2 Antibody: synthetic peptide directed towards the middle region of human HK2. Synthetic peptide located within the following region: QRIKENKGEERLRSTIGVDGSVYKKHPHFAKRLHKTVRRLVPGCDVRFLR

Rabbit Polyclonal Anti-PGM1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PGM1 antibody: synthetic peptide directed towards the middle region of human PGM1. Synthetic peptide located within the following region: TVEKADNFEYSDPVDGSISRNQGLRLIFTDGSRIVFRLSGTGSAGATIRL

Rabbit Polyclonal Anti-PGM1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PGM1 antibody: synthetic peptide directed towards the middle region of human PGM1. Synthetic peptide located within the following region: ATIRLYIDSYEKDVAKINQDPQVMLAPLISIALKVSQLQERTGRTAPTVI

Rabbit Polyclonal Anti-PFKL Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PFKL antibody: synthetic peptide directed towards the middle region of human PFKL. Synthetic peptide located within the following region: RTNVLGHLQQGGAPTPFDRNYGTKLGVKAMLWLSEKLREVYRKGRVFANA

Rabbit Polyclonal Anti-HK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HK1 antibody: synthetic peptide directed towards the middle region of human HK1. Synthetic peptide located within the following region: ILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTR

Rabbit Polyclonal Anti-HK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HK1 antibody: synthetic peptide directed towards the N terminal of human HK1. Synthetic peptide located within the following region: CQQSKIDEAILITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVV

Rabbit Polyclonal Anti-PFKM Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PFKM antibody: synthetic peptide directed towards the C terminal of human PFKM. Synthetic peptide located within the following region: RALVFQPVAELKDQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSDHA

Mouse Monoclonal AKR1B1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Mouse Monoclonal AKR1B1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Mouse Monoclonal Hexokinase 1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated