Antibodies

View as table Download

Rabbit Polyclonal antibody to GALNS (galactosamine (N-acetyl)-6-sulfate sulfatase)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 20 and 259 of GALNS

Rabbit anti-SPAM1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SPAM1

Goat Polyclonal Antibody against Arylsulfatase B

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KLARGHTNGTKPLD, from the internal region of the protein sequence according to NP_000037.2; NP_942002.1.

Rabbit polyclonal antibody to beta-Gal (galactosidase, beta 1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 166 and 677 of beta-Gal (Uniprot ID#P16278)

Goat Anti-IDS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KHFRFRDLEEDP, from the internal region of the protein sequence according to NP_000193.1.

Rabbit anti-GLB1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GLB1

Rabbit anti-HPSE Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HPSE

Rabbit polyclonal antibody to SGSH (N-sulfoglucosamine sulfohydrolase)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 318 and 496 of SGSH (Uniprot ID#P51688)

Rabbit anti-GALNS Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GALNS

Rabbit Polyclonal Anti-SGSH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SGSH antibody is: synthetic peptide directed towards the N-terminal region of Human SGSH. Synthetic peptide located within the following region: RNALLLLADDGGFESGAYNNSAIATPHLDALARRSLLFRNAFTSVSSCSP

Rabbit polyclonal anti-GUSB antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GUSB.

Rabbit polyclonal GALNS Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This GALNS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-263 amino acids from the Central region of human GALNS.

Rabbit anti-HEXA Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HEXA

Rabbit Polyclonal Anti-SGSH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SGSH antibody is: synthetic peptide directed towards the C-terminal region of Human SGSH. Synthetic peptide located within the following region: ARWELYDRSRDPHETQNLATDPRFAQLLEMLRDQLAKWQWETHDPWVCAP

Rabbit polyclonal antibody to SGSH (N-sulfoglucosamine sulfohydrolase)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 44 and 230 of SGSH (Uniprot ID#P51688)

Rabbit polyclonal anti-HEXB antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human HEXB.

Anti-HPSE Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a C terminal 250 amino acids of human heparanase

Rabbit Polyclonal ARSB Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ARSB antibody was raised against a 16 amino acid peptide near the carboxy terminus of human ARSB

Rabbit Polyclonal Anti-HYAL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HYAL1 antibody: synthetic peptide directed towards the N terminal of human HYAL1. Synthetic peptide located within the following region: TIFYSSQLGTYPYYTPTGEPVFGGLPQNASLIAHLARTFQDILAAIPAPD

Rabbit polyclonal anti-GLB1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GLB1.

Anti-HPSE Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a C terminal 250 amino acids of human heparanase

Rabbit Polyclonal Anti-GUSB Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GUSB antibody: synthetic peptide directed towards the C terminal of human GUSB. Synthetic peptide located within the following region: VLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSPF

Rabbit Polyclonal Anti-SPAM1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SPAM1 antibody is: synthetic peptide directed towards the C-terminal region of Human SPAM1. Synthetic peptide located within the following region: CYSTLSCKEKADVKDTDAVDVCIADGVCIDAFLKPPMETEEPQIFYNASP

Rabbit Polyclonal Anti-HGSNAT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HGSNAT antibody is: synthetic peptide directed towards the C-terminal region of Human HGSNAT. Synthetic peptide located within the following region: VKGLWTGTPFFYPGMNSILVYVGHEVFENYFPFQWKLKDNQSHKEHLTQN

Rabbit Polyclonal Anti-HYAL1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HYAL1 antibody: synthetic peptide directed towards the N terminal of human HYAL1. Synthetic peptide located within the following region: WNANTQWCLERHGVDVDVSVFDVVANPGQTFRGPDMTIFYSSQLGTYPYY

Rabbit Polyclonal Anti-IDS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IDS antibody: synthetic peptide directed towards the N terminal of human IDS. Synthetic peptide located within the following region: SFPPYHPSSEKYENTKTCRGPDGELHANLLCPVDVLDVPEGTLPDKQSTE

Rabbit Polyclonal Anti-HEXA Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HEXA antibody: synthetic peptide directed towards the C terminal of human HEXA. Synthetic peptide located within the following region: WKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAV

Goat Polyclonal Antibody against GALNS

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TTHNLEDHTKLP, from the internal region of the protein sequence according to NP_000503.1.

Rabbit polyclonal anti-ARSB antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human ARSB.

Rabbit Polyclonal Anti-HGSNAT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HGSNAT antibody is: synthetic peptide directed towards the N-terminal region of Human HGSNAT. Synthetic peptide located within the following region: RALAALLLAASVLSAALLAPGGSSGRDAQAAPPRDLDKKRHAELKMDQAL

Rabbit Polyclonal Anti-HPSE2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HPSE2 antibody is: synthetic peptide directed towards the N-terminal region of Human HPSE2. Synthetic peptide located within the following region: SPAFLRFGGKRTDFLQFQNLRNPAKSRGGPGPDYYLKNYEDEPNNYRTMH

Rabbit Polyclonal Anti-HS3ST3B1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HS3ST3B1 antibody: synthetic peptide directed towards the N terminal of human HS3ST3B1. Synthetic peptide located within the following region: AMLCVWLYMFLYSCAGSCAAAPGLLLLGSGSRAAHDPPALATAPDGTPPR

Rabbit Polyclonal Anti-HPSE Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HPSE antibody: synthetic peptide directed towards the N terminal of human HPSE. Synthetic peptide located within the following region: DPRFLILLGSPKLRTLARGLSPAYLRFGGTKTDFLIFDPKKESTFEERSY

Rabbit Polyclonal Anti-HPSE Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HPSE antibody: synthetic peptide directed towards the N terminal of human HPSE. Synthetic peptide located within the following region: KLRLEWPYQEQLLLREHYQKKFKNSTYSRSSVDVLYTFANCSGLDLIFGL

Rabbit Polyclonal Anti-IDUA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IDUA antibody is: synthetic peptide directed towards the C-terminal region of Human IDUA. Synthetic peptide located within the following region: DPVAAAPRPLPAGGRLTLRPALRLPSLLLVHVCARPEKPPGQVTRLRALP

Rabbit Polyclonal Anti-IDUA Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Idua antibody is: synthetic peptide directed towards the middle region of MOUSE Idua. Synthetic peptide located within the following region: MENQLLPGFELMGSPSGYFTDFDDKQQVFEWKDLVSLLARRYIGRYGLTH

Carrier-free (BSA/glycerol-free) IDS mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) IDS mouse monoclonal antibody, clone OTI3B10 (formerly 3B10)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) IDS mouse monoclonal antibody, clone OTI4G2 (formerly 4G2)

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GLB1 mouse monoclonal antibody, clone OTI1E10 (formerly 1E10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GLB1 mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)

Applications IHC, WB
Reactivities Human, Monkey, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GLB1 mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GLB1 mouse monoclonal antibody, clone OTI5H2 (formerly 5H2)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GLB1 mouse monoclonal antibody, clone OTI10B2 (formerly 10B2)

Applications IF, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ARSB mouse monoclonal antibody, clone OTI4G7

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ARSB mouse monoclonal antibody, clone OTI6G9

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ARSB mouse monoclonal antibody, clone OTI2A5

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-HYAL2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human HYAL2

Rabbit Polyclonal Anti-HYAL3 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human HYAL3

Rabbit Polyclonal Anti-ARSB Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ARSB