Germany
Japan
United Kingdom
China
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR094F2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Goat Polyclonal Anti-BDNF Antibody
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BDNF Antibody: Peptide with sequence ETKCNPMGYTKE, from the internal region of the protein sequence according to NP_001700.2; NP_001700.2; NP_733928.1; NP_733929.1; NP_733930.1; NP_733931.1. |
Rabbit Polyclonal CD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA |
Goat Polyclonal Anti-CD4 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within 50 to 235 aa, corresponding to the external domain of human CD4 produced in E. coli. |
Rabbit polyclonal Neuro D (Ser274) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Neuro D around the phosphorylation site of serine 274 (P-L-SP-P-P). |
| Modifications | Phospho-specific |
Rabbit Polyclonal CD44 (Ser706) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CD44 around the phosphorylation site of Serine 706 |
| Modifications | Phospho-specific |
Chicken Anti-Microtubule Associated Protein 2 (MAP2) Antibody
| Applications | WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Bovine MAP2 isolated from brain by the GTP microtubule cycling method |
Rabbit Polyclonal Antibody against SOX2 - Embryonic Stem Cell Marker
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Sheep |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human SOX2 protein (within residues 1-100). [Swiss-Prot# P48431] |
Goat Polyclonal Anti-Histone Deacetylase 1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse (Expected from sequence similarity: Rat, Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Histone Deacetylase 1 Antibody: Peptide with sequence C-KPEAKGVKEEVK, from the C Terminus of the protein sequence according to NP_004955.2. |
Rabbit Polyclonal GATA3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | GATA3 antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human GATA3. The immunogen is located within amino acids 340 - 390 of GATA3. |
Rabbit polyclonal APOE antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human APOE. |
Goat Polyclonal Anti-cardiac troponin T (aa201-213) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Pig (Expected from sequence similarity: Feline, Rat, Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-cardiac troponin T (aa201-213) Antibody: Peptide with sequence C-TERKSGKRQTERE, from the internal region of the protein sequence according to NP_000355.2; NP_001001430.1; NP_001001431.1; NP_001001432.1. |
Rabbit Polyclonal Antibody against SOX2 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SOX2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 89-119 amino acids from the N-terminal region of human SOX2. |
Rabbit polyclonal KLF4 Antibody (N-term C74)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This KLF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 69-101 amino acids from the N-terminal region of human KLF4. |
Rabbit anti-IGFBP1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human IGFBP1 |
Rabbit Polyclonal Anti-DKK2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DKK2 |
Rabbit polyclonal SOX-9 (Ser181) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human SOX-9 around the phosphorylation site of serine 181 (R-K-SP-V-K). |
| Modifications | Phospho-specific |
Mouse Monoclonal CDX2 Antibody
| Applications | IF, IP, WB |
| Reactivities | Human, Monkey, Mouse |
| Conjugation | Unconjugated |
Active filters
Reactivities
- Mouse
Families
- Adult stem cells
Filter by
Category
Target Symbol
- GLI1 (150)
- EGFR (143)
- ERBB3 (54)
- GATA3 (49)
- HES1 (46)
- TAL1 (46)
- CDX2 (45)
- HDAC1 (38)
- HGF (28)
- MAP2 (24)
- NOTCH1 (23)
- SOX9 (23)
- BMP6 (22)
- GLI2 (21)
- BMP4 (20)
- SOX2 (19)
- SMURF2 (17)
- PAX7 (12)
- CD44 (11)
- PAX3 (10)
- GATA1 (9)
- POU5F1 (9)
- KIT (8)
- KLF4 (8)
- LEF1 (8)
- BDNF (7)
- CD9 (7)
- IGFBP2 (7)
- SOX1 (7)
- FGF4 (6)
- HNF1A (6)
- DKK2 (5)
- PDGFC (5)
- CD4 (4)
- NEUROD1 (4)
- WNT1 (4)
- WNT3A (4)
- APOE (3)
- BMP2 (3)
- EGF (3)
- LIF (3)
- PAX6 (3)
- SFRP1 (3)
- WNT6 (3)
- CCN4 (2)
- CD34 (2)
- DKK1 (2)
- DKK4 (2)
- FGF7 (2)
- GATA2 (2)
- IGFBP1 (2)
- WNT2 (2)
- WNT5A (2)
- BMP15 (1)
- BMP5 (1)
- BMP7 (1)
- DLL1 (1)
- FGF10 (1)
- FGF21 (1)
- GDF3 (1)
- GDF5 (1)
- GDF7 (1)
- GDF9 (1)
- GLI3 (1)
- SFRP4 (1)
- SFRP5 (1)
- SOX10 (1)
- WNT7B (1)
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Pathways
- Pathways in cancer (449)
- Hedgehog signaling pathway (235)
- Endocytosis (228)
- Basal cell carcinoma (219)
- ErbB signaling pathway (200)
- Calcium signaling pathway (197)
- Cytokine-cytokine receptor interaction (195)
- Melanoma (189)
- Focal adhesion (179)
- Dorso-ventral axis formation (166)
- MAPK signaling pathway (163)
- Regulation of actin cytoskeleton (161)
- Prostate cancer (159)
- Endometrial cancer (154)
- Adherens junction (151)
- Colorectal cancer (151)
- Gap junction (151)
- Bladder cancer (146)
- Glioma (146)
- Non-small cell lung cancer (146)
- Pancreatic cancer (146)
- Epithelial cell signaling in Helicobacter pylori infection (143)
- GnRH signaling pathway (143)
- Notch signaling pathway (108)
- TGF-beta signaling pathway (66)
- Maturity onset diabetes of the young (59)
- Huntington's disease (45)
- Cell cycle (38)
- Chronic myeloid leukemia (38)
- Wnt signaling pathway (38)
- Hematopoietic cell lineage (35)
- Melanogenesis (35)
- Renal cell carcinoma (28)
- Cell adhesion molecules (CAMs) (23)
- Prion diseases (23)
- Antigen processing and presentation (21)
- Acute myeloid leukemia (19)
- Allograft rejection (17)
- Autoimmune thyroid disease (17)
- Graft-versus-host disease (17)
- Type I diabetes mellitus (17)
- Ubiquitin mediated proteolysis (17)
- Viral myocarditis (17)
- ECM-receptor interaction (11)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (8)
- Thyroid cancer (8)
- Neurotrophin signaling pathway (7)
- Primary immunodeficiency (4)
- T cell receptor signaling pathway (4)
- Alzheimer's disease (3)
- Jak-STAT signaling pathway (3)