Germany
Japan
United Kingdom
China
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR094F2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Goat Polyclonal Antibody against DKK1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CDHHQASNSSRLHT, from the C Terminus of the protein sequence according to NP_036374. |
Goat Polyclonal Anti-BDNF Antibody
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BDNF Antibody: Peptide with sequence ETKCNPMGYTKE, from the internal region of the protein sequence according to NP_001700.2; NP_001700.2; NP_733928.1; NP_733929.1; NP_733930.1; NP_733931.1. |
Rabbit Polyclonal CD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
Goat Polyclonal Anti-CD4 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within 50 to 235 aa, corresponding to the external domain of human CD4 produced in E. coli. |
Rabbit polyclonal Neuro D (Ser274) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Neuro D around the phosphorylation site of serine 274 (P-L-SP-P-P). |
| Modifications | Phospho-specific |
Rabbit Polyclonal CD44 (Ser706) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CD44 around the phosphorylation site of Serine 706 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-SOX9 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOX9 antibody: synthetic peptide directed towards the C terminal of human SOX9. Synthetic peptide located within the following region: AGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQ |
Chicken Anti-Microtubule Associated Protein 2 (MAP2) Antibody
| Applications | WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Bovine MAP2 isolated from brain by the GTP microtubule cycling method |
Goat Polyclonal Anti-Histone Deacetylase 1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse (Expected from sequence similarity: Rat, Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Histone Deacetylase 1 Antibody: Peptide with sequence C-KPEAKGVKEEVK, from the C Terminus of the protein sequence according to NP_004955.2. |
Rabbit Polyclonal GATA3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | GATA3 antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human GATA3. The immunogen is located within amino acids 340 - 390 of GATA3. |
Rabbit polyclonal APOE antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human APOE. |
Goat Polyclonal Anti-cardiac troponin T (aa201-213) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Pig (Expected from sequence similarity: Feline, Rat, Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-cardiac troponin T (aa201-213) Antibody: Peptide with sequence C-TERKSGKRQTERE, from the internal region of the protein sequence according to NP_000355.2; NP_001001430.1; NP_001001431.1; NP_001001432.1. |
Rabbit anti-IGFBP1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human IGFBP1 |
Rabbit polyclonal EGFR (Thr693) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human: Thr693, Mouse: Thr695, Rat: Thr694 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of threonine 693 (P-L-TP-P-S). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-Wnt-6 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 276 of mouse Wnt-6 |
Anti-ERBB3 (phospho-Tyr1328) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of tyrosine 1328 (P-D-Y(p)-W-H) derived from Human Her3/ErbB3. |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-HDAC1 antibody, Loading control
| Applications | IF, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | This HDAC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 70-99 amino acids from the N-terminal region of human HDAC1. |
FGF10 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FGF10 |
Rabbit Polyclonal Anti-BMP6 Antibody - middle region
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BMP6 antibody: synthetic peptide directed towards the middle region of human BMP6. Synthetic peptide located within the following region: MVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSEL |
Rabbit Polyclonal Anti-Neuro D Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Neuro D Antibody: A synthesized peptide derived from human Neuro D |
Active filters
Reactivities
- Rat
Families
- Adult stem cells
Filter by
Category
Target Symbol
- GLI1 (148)
- EGFR (139)
- ERBB3 (54)
- HES1 (46)
- TAL1 (46)
- GATA3 (45)
- CDX2 (42)
- HDAC1 (38)
- HGF (28)
- BMP6 (23)
- BMP4 (20)
- NOTCH1 (20)
- SOX9 (20)
- CD4 (19)
- SMURF2 (16)
- SOX2 (15)
- PAX7 (11)
- MAP2 (9)
- POU5F1 (9)
- GATA1 (8)
- LEF1 (8)
- CD9 (7)
- PAX3 (7)
- BDNF (6)
- CD44 (6)
- HNF1A (6)
- IGFBP2 (6)
- KLF4 (6)
- FGF4 (5)
- KIT (5)
- NEUROD1 (4)
- BMP2 (3)
- DKK2 (3)
- EGF (3)
- SOX1 (3)
- APOE (2)
- CCN4 (2)
- CD34 (2)
- DKK4 (2)
- DLL1 (2)
- FGF7 (2)
- IGFBP1 (2)
- LIF (2)
- PDGFC (2)
- SFRP1 (2)
- WNT5A (2)
- WNT6 (2)
- BMP5 (1)
- BMP7 (1)
- DKK1 (1)
- FGF10 (1)
- GDF3 (1)
- GDF9 (1)
- GLI3 (1)
- PAX6 (1)
- SFRP4 (1)
- SOX10 (1)
- WNT1 (1)
- WNT2 (1)
Applications
Antibody Hosts
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Pathways
- Pathways in cancer (407)
- Endocytosis (220)
- Hedgehog signaling pathway (203)
- ErbB signaling pathway (196)
- Calcium signaling pathway (193)
- Basal cell carcinoma (186)
- Cytokine-cytokine receptor interaction (183)
- Melanoma (180)
- Focal adhesion (172)
- Dorso-ventral axis formation (159)
- MAPK signaling pathway (156)
- Prostate cancer (152)
- Regulation of actin cytoskeleton (152)
- Endometrial cancer (150)
- Adherens junction (147)
- Colorectal cancer (147)
- Gap junction (144)
- Bladder cancer (142)
- Glioma (142)
- Non-small cell lung cancer (142)
- Pancreatic cancer (142)
- Epithelial cell signaling in Helicobacter pylori infection (139)
- GnRH signaling pathway (139)
- Notch signaling pathway (106)
- TGF-beta signaling pathway (64)
- Maturity onset diabetes of the young (57)
- Huntington's disease (44)
- Hematopoietic cell lineage (42)
- Cell cycle (38)
- Chronic myeloid leukemia (38)
- Cell adhesion molecules (CAMs) (37)
- Antigen processing and presentation (35)
- Renal cell carcinoma (28)
- Wnt signaling pathway (23)
- Melanogenesis (22)
- Prion diseases (20)
- Primary immunodeficiency (19)
- T cell receptor signaling pathway (19)
- Acute myeloid leukemia (16)
- Allograft rejection (16)
- Autoimmune thyroid disease (16)
- Graft-versus-host disease (16)
- Type I diabetes mellitus (16)
- Ubiquitin mediated proteolysis (16)
- Viral myocarditis (16)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (8)
- Thyroid cancer (8)
- ECM-receptor interaction (6)
- Neurotrophin signaling pathway (6)
- Alzheimer's disease (2)
- Jak-STAT signaling pathway (2)