Rabbit monoclonal antibody against CD13(clone EPR4058)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit monoclonal antibody against CD13(clone EPR4058)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CD13 (ANPEP) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide, corresponding to amino acids 880-930 of Human CD13. |
Rabbit anti-ANPEP Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ANPEP |
Rabbit Polyclonal Aminopeptidase A/APA Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Goat Polyclonal Antibody against ENPEP
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EQYQKTSLAQEKEK, from the internal region of the protein sequence according to NP_001968.2. |
USD 380.00
4 Weeks
Mouse Monoclonal Angiotensin Converting Enzyme 1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ACE1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACE1 Antibody: A synthesized peptide derived from human ACE1 |
Aminopeptidase A (ENPEP) (689-032) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | Recombinant protein fragment containing a sequence corresponding to a region within amino acids 689 and 932 of Human ENPEP |
Aminopeptidase A (ENPEP) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 906-938 amino acids from the C-terminal region of Human ENPEP. |
CD13 (ANPEP) mouse monoclonal antibody, clone B-F10, PE
Applications | FC |
Reactivities | Human |
Conjugation | PE |
Angiotensin Converting Enzyme 1 (ACE) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CD13 (ANPEP) mouse monoclonal antibody, clone WM15, Biotin
Applications | FC |
Reactivities | Human, Primate |
Conjugation | Biotin |
Rabbit Polyclonal Anti-ANPEP Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ANPEP antibody: synthetic peptide directed towards the N terminal of human ANPEP. Synthetic peptide located within the following region: VGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLA |
CD13 (ANPEP) mouse monoclonal antibody, clone B-F10, Azide Free
Applications | FC |
Reactivities | Human |
CD13 (ANPEP) mouse monoclonal antibody, clone B-F10, FITC
Applications | FC |
Reactivities | Human |
Conjugation | FITC |
CD13 (ANPEP) mouse monoclonal antibody, clone B-F10, Purified
Applications | FC |
Reactivities | Human |
CD13 (ANPEP) mouse monoclonal antibody, clone WM15, APC
Applications | FC |
Reactivities | Human, Primate |
Conjugation | APC |
CD13 (ANPEP) mouse monoclonal antibody, clone WM15, FITC
Applications | FC |
Reactivities | Human, Primate |
Conjugation | FITC |
CD13 (ANPEP) mouse monoclonal antibody, clone WM15, PE
Applications | FC |
Reactivities | Human, Primate |
Conjugation | PE |
Mouse Anti-Human CD13 Purified (100 ug)
Applications | FC |
Reactivities | Human |
Conjugation | Unconjugated |
Goat Anti-CD13 / ANPEP (aa79-91) Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-TLKPDSYRVTLRP, from the internal region (near N terminus) of the protein sequence according to NP_001141.2 |
Goat Anti-CD13 / ANPEP Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QLEQFKKDNEET, from the internal region (near C terminus) of the protein sequence according to NP_001141.2 |
Carrier-free (BSA/glycerol-free) ENPEP mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ENPEP mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ENPEP mouse monoclonal antibody, clone OTI3E7 (formerly 3E7)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ENPEP mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ENPEP mouse monoclonal antibody, clone OTI1D4 (formerly 1D4)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ENPEP mouse monoclonal antibody, clone OTI3G1 (formerly 3G1)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ENPEP mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ENPEP mouse monoclonal antibody, clone OTI4G8 (formerly 4G8)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ANPEP mouse monoclonal antibody, clone OTI2E4 (formerly 2E4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ANPEP mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ANPEP mouse monoclonal antibody, clone OTI3F8 (formerly 3F8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) ACE mouse monoclonal antibody,clone OTI2C8
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) ACE mouse monoclonal antibody,clone OTI2G5
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-ACE1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 78-92 amino acids of Human Angiotensin-converting enzyme |
Anti-ACE1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 78-92 amino acids of Human Angiotensin-converting enzyme |
Rabbit Polyclonal Anti-ANPEP Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ANPEP |
Rabbit Polyclonal Anti-ACE Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ACE |
ENPEP mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ENPEP mouse monoclonal antibody, clone OTI1D1 (formerly 1D1), Biotinylated
Applications | FC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
ENPEP mouse monoclonal antibody, clone OTI1D1 (formerly 1D1), HRP conjugated
Applications | FC, WB |
Reactivities | Human |
Conjugation | HRP |
ENPEP mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
ENPEP mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ENPEP mouse monoclonal antibody, clone OTI1D6 (formerly 1D6), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
ENPEP mouse monoclonal antibody, clone OTI1D6 (formerly 1D6), HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | HRP |
ENPEP mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
ENPEP mouse monoclonal antibody, clone OTI3E7 (formerly 3E7)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ENPEP mouse monoclonal antibody, clone OTI3E7 (formerly 3E7), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
ENPEP mouse monoclonal antibody, clone OTI3E7 (formerly 3E7), HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | HRP |