Germany
Japan
United Kingdom
China
Antibodies
Download
Anti-LGR5 mouse mAb, clone OTI2A2, DyLight 488 conjugated
| Applications | FC |
| Reactivities | Human, Mouse |
| Conjugation | DyLight 488 |
Anti-LGR5 mouse mAb, clone OTI2A2, bionylated
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Biotin |
GPR44 / CRTH2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | GPR44 / CRTH2 antibody was raised against synthetic 33 amino acid peptide from N-terminal extracellular domain of human GPR44 / CRTH2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (91%); Dog, Pig (88%); Rabbit (85%); Bovine (82%). |
Anti-LGR5 mouse mAb, clone OTI2A2, DyLight633 conjugated
| Applications | FC |
| Reactivities | Human, Mouse |
| Conjugation | DyLight 633 |
Rabbit Polyclonal Anti-Angiotensin II Receptor Type-1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide NSSTEDGIKRIQDDC, corresponding to amino acid residues 4-18 of human AT1 receptor. Extracellular, N-terminus. |
Anti-LGR5 mouse mAb, clone OTI2A2, DyLight 550 conjugated
| Reactivities | Human, Mouse |
| Conjugation | DyLight 550 |
GRPR Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Dog, Gorilla, Horse, Human, Monkey, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | GRPR antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human GRPR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Panda, Dog, Bat, Horse, Rabbit, Pig (100%); Bovine (94%); Mouse, Rat, Hamster (83%). |
B1R / BDKRB1 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | B1R / BDKRB1 antibody was raised against synthetic 16 amino acid peptide from 1st cytoplasmic domain of human BDKRB1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (94%); Horse (81%). |
Anti-LGR5 mouse mAb, clone OTI2A2, HRP conjugated
| Reactivities | Human, Mouse |
| Conjugation | HRP |
Rabbit Polyclonal Anti-OR51E2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR51E2 antibody is: synthetic peptide directed towards the C-terminal region of Human OR51E2. Synthetic peptide located within the following region: VRVVMGDIYLLLPPVINPIIYGAKTKQIRTRVLAMFKISCDKDLQAVGGK |
Rat Anti-Human CD197 (CCR7) Purified (100 ug)
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-NPY1R Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NPY1R antibody: synthetic peptide directed towards the middle region of human NPY1R. Synthetic peptide located within the following region: TDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFI |
Rabbit Polyclonal Anti-ADORA2B Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ADORA2B antibody was raised against a 19 amino acid peptide near the carboxy terminus of human ADORA2B. The immunogen is located within the last 50 amino acids of ADORA2B. |
Rabbit Polyclonal S1P1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | S1P1 antibody was raised against a 14 amino acid synthetic peptide near the carboxy terminus of the human S1P1. The immunogen is located within the last 50 amino acids of S1P1. |
Rabbit Polyclonal Anti-CYSLTR1 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CYSLTR1 / CYSLT1 antibody was raised against synthetic 20 amino acid peptide from C-terminus of human CYSLTR1 / CYSLT1. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey, Marmoset (95%); Gibbon, Mouse, Panda (90%); Rat, Bovine, Elephant, Rabbit, Pig (85%). |
Rabbit Polyclonal Anti-GPR161 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPR161 antibody: synthetic peptide directed towards the middle region of human GPR161. Synthetic peptide located within the following region: SISNRITDLGLSPHLTALMAGGQPLGHSSSTGDTGFSCSQDSGTDMMLLE |
5HT7 Receptor (HTR7) (8-23) rabbit polyclonal antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Dopamine D2 Receptor / DRD2 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Chimpanzee, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | DRD2 / Dopamine Receptor D2 antibody was raised against synthetic 19 amino acid peptide from 3rd cytoplasmic domain of human DRD2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Marmoset (100%); Gibbon, Monkey, Rabbit (95%); Dog, Bovine, Panda, Horse, Pig (89%); Mouse, Rat, Ferret, Bat, Hamster, Elephant (84%). |
Rabbit Polyclonal Anti-OR51E2 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | OR51E2 / PSGR antibody was raised against synthetic 14 amino acid peptide from N-terminal extracellular domain of human OR51E2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Galago, Marmoset, Hamster, Bat, Rabbit, Pig (100%); Mouse, Rat, Elephant, Panda, Bovine (93%); Horse (86%). |
Rabbit Polyclonal CX3CR1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | CX3CR1 antibody was raised against a 20 amino acid peptide near the amino terminus of human CX3CR1. The immunogen is located within the first 50 amino acids of CX3CR1. |
Rabbit Polyclonal CXCR4 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | CXCR4 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human CXCR4. The immunogen is located within the first 50 amino acids of CXCR4. |
Rabbit polyclonal anti-SPR1 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SPR1. |
Dopamine Receptor D3 / DRD3 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Chimpanzee, Gorilla, Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | DRD3 / Dopamine Receptor D3 antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human DRD3 / Dopamine Receptor D3. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Monkey, Marmoset (100%); Gibbon, Mouse, Dog, Bovine, Bat, Hamster, Elephant, Panda, Horse, Rabbit (94%); Rat, Pig, Opossum (88%). |
Rabbit anti-SIGMAR1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SIGMAR1 |
Rabbit Polyclonal Anti-FZD9 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD9 antibody: synthetic peptide directed towards the N terminal of human FZD9. Synthetic peptide located within the following region: RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF |
Rabbit Polyclonal Anti-CALCRL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CALCRL antibody: synthetic peptide directed towards the N terminal of human CALCRL. Synthetic peptide located within the following region: DGNWFRHPASNRTWTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLL |
Rabbit polyclonal antibody to GPR4 (G protein-coupled receptor 4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 159 and 254 of GPR4 (Uniprot ID#P46093) |
CCR6 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Human, Gorilla |
| Conjugation | Unconjugated |
| Immunogen | CCR6 antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human CCR6. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon (94%); Monkey (89%); Opossum (83%). |
Dopamine Receptor D1 / DRD1 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | DRD1 / Dopamine Receptor D1 antibody was raised against synthetic 20 amino acid peptide from 2nd extracellular domain of human DRD1. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon, Marmoset (95%); Elephant (90%); Dog, Rabbit (85%); Horse (80%). |
Rabbit Polyclonal Anti-GPR68 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPR68 antibody is: synthetic peptide directed towards the middle region of Human GPR68. Synthetic peptide located within the following region: SIYFLMHEEVIEDENQHRVCFEHYPIQAWQRAINYYRFLVGFLFPICLLL |
Rabbit Polyclonal Antibody against OPRS1 (N-term)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This OPRS1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 47-81 amino acids from the N-terminal region of human OPRS1. |
Active filters
Reactivities
- Human
Families
- GPCR
Filter by
Target Symbol
- LGR5 (84)
- GPR17 (38)
- CXCR4 (17)
- LGR4 (13)
- SSTR3 (13)
- ADRA1B (11)
- F2R (11)
- ADRB2 (10)
- GRM4 (10)
- CCR5 (9)
- CCR7 (9)
- GRM3 (9)
- PTGER3 (9)
- S1PR1 (9)
- SSTR2 (9)
- SSTR5 (9)
- CASR (8)
- CHRM1 (8)
- CX3CR1 (8)
- CXCR2 (8)
- CXCR3 (8)
- FPR2 (8)
- HCRTR1 (8)
- HTR7 (8)
- LPAR1 (8)
- P2RY2 (8)
- SSTR4 (8)
- TSHR (8)
- AVPR1B (7)
- CNR2 (7)
- FZD4 (7)
- GABBR1 (7)
- GRM1 (7)
- GRM7 (7)
- HTR1A (7)
- HTR1F (7)
- HTR4 (7)
- KISS1R (7)
- NTSR1 (7)
- S1PR3 (7)
- SSTR1 (7)
- ADORA2A (6)
- ADRA2A (6)
- ADRB3 (6)
- APLNR (6)
- BDKRB1 (6)
- CCR8 (6)
- CYSLTR1 (6)
- FPR1 (6)
- GNRHR (6)
- GRM2 (6)
- GRM8 (6)
- HRH4 (6)
- HTR2C (6)
- HTR5A (6)
- LPAR4 (6)
- MAS1 (6)
- MC1R (6)
- MC4R (6)
- MTNR1A (6)
- NPY1R (6)
- OPN3 (6)
- OPRM1 (6)
- RXFP3 (6)
- TACR1 (6)
- ACKR4 (5)
- ADORA3 (5)
- ADRA1A (5)
- AGTR1 (5)
- AVPR1A (5)
- CCR1 (5)
- CHRM5 (5)
- CMKLR1 (5)
- CXCR6 (5)
- DRD1 (5)
- EDNRA (5)
- FSHR (5)
- FZD1 (5)
- FZD10 (5)
- FZD2 (5)
- GHRHR (5)
- GHSR (5)
- GIPR (5)
- GPR12 (5)
- GPR173 (5)
- GPR26 (5)
- GPR3 (5)
- GPR4 (5)
- GPR68 (5)
- GPR75 (5)
- GRM5 (5)
- GRPR (5)
- HRH1 (5)
- HRH2 (5)
- MC2R (5)
- MC5R (5)
- NMBR (5)
- OR51E1 (5)
- P2RY13 (5)
- PTGDR (5)
Applications
Antibody Hosts
Clonalities
Conjugates
Modifications
Pathways
- Neuroactive ligand-receptor interaction (739)
- Calcium signaling pathway (234)
- Chemokine signaling pathway (98)
- Cytokine-cytokine receptor interaction (98)
- Endocytosis (69)
- Vascular smooth muscle contraction (56)
- Melanogenesis (46)
- Regulation of actin cytoskeleton (39)
- Gap junction (38)
- Basal cell carcinoma (37)
- Colorectal cancer (37)
- Pathways in cancer (37)
- Wnt signaling pathway (37)
- Complement and coagulation cascades (27)
- Axon guidance (17)
- Leukocyte transendothelial migration (17)
- Olfactory transduction (17)
- Long-term depression (15)
- Renin-angiotensin system (15)
- Epithelial cell signaling in Helicobacter pylori infection (12)
- Long-term potentiation (12)
- Taste transduction (10)
- Autoimmune thyroid disease (8)
- GnRH signaling pathway (6)
- Huntington's disease (5)
- Dilated cardiomyopathy (4)
- Parkinson's disease (4)