Germany
Japan
United Kingdom
China
Rabbit monoclonal anti-CATB antibody for SISCAPA, clone OTIR1C4
| Applications | SISCAPA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Cathepsin L (CTSL) mouse monoclonal antibody, clone CP-L14, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
Rabbit polyclonal CATL1 (heavy chain, Cleaved-Thr288) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human CATL1. |
Cathepsin S (CTSS) mouse monoclonal antibody, clone AT1F9, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
Cathepsin S (CTSS) mouse monoclonal antibody, clone AT1F9, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
Rabbit Polyclonal Anti-CTSS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTSS antibody: synthetic peptide directed towards the N terminal of human CTSS. Synthetic peptide located within the following region: QLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEH |
Rabbit anti Legumain Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the internal sequence (a portion from 100aa-190aa) of human Legumain protein. This sequence is identical to mouse, human and rat. |
Cathepsin S (CTSS) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human CTSS |
Rabbit polyclonal anti-Cathepsin L antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 223 of human Cathepsin L |
Rabbit Polyclonal Anti-LGMN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-LGMN antibody is: synthetic peptide directed towards the middle region of Human LGMN. Synthetic peptide located within the following region: KMVFYIEACESGSMMNHLPDNINVYATTAANPRESSYACYYDEKRSTYLG |
Rabbit Polyclonal Anti-LGMN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-LGMN antibody is: synthetic peptide directed towards the middle region of Human LGMN. Synthetic peptide located within the following region: ESSYACYYDEKRSTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTN |
Anti-CTSB Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 80-333 amino acids of human cathepsin B |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Families
- Protease
Pathways
- Antigen processing and presentation