Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal Anti-HSPA8 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL |
Rabbit monoclonal anti-PDIA3 antibody for SISCAPA, clone OTIR5G4
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-CATB antibody for SISCAPA, clone OTIR1C4
| Applications | SISCAPA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal HLA-G Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HLA-G antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the Central region of human HLA-G. |
USD 750.00
In Stock
Rabbit Polyclonal Anti-ARC Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ARC |
TA349251 is a possible alternative to TA349500.
Rabbit Polyclonal Anti-HSPA8 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: VVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAE |
Rabbit polyclonal anti-HSPA1A(HSP70) antibody, Loading control
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 308 and 569 of HSP70 1A |
CD4 mouse monoclonal antibody, clone B-A1, Azide Free
| Applications | FC, FN, IHC |
| Reactivities | Human |
Rabbit Polyclonal CD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
DHLAG (CD74) mouse monoclonal antibody, clone LN2, Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Baboon |
Goat Polyclonal Anti-CD4 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within 50 to 235 aa, corresponding to the external domain of human CD4 produced in E. coli. |
DHLAG (CD74) mouse monoclonal antibody, clone LN2, Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Baboon |
Rabbit polyclonal antibody to CD74 (CD74 molecule, major histocompatibility complex, class II invariant chain)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 58 of CD74 (Uniprot ID#P04233) |
Rabbit Polyclonal Calnexin Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Hamster |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal portion of the rat Calnexin protein (between residues 550-591) [UniProt P35565] |
Rabbit Polyclonal Antibody against CD8A (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 59-88 amino acids from the N-terminal region of human CD8A. |
Goat Polyclonal Antibody against HSPA8 (Isoform 1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EKLQGKINDEDKQK, from the internal region of the protein sequence according to NP_006588.1. |
Anti-HLA-DRA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 26-216 amino acids of human major histocompatibility complex, class II, DR alpha |
Mouse monoclonal Hsp70/Hsc70 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Bovine, C.elegans, Beluga, Canine, Chicken, Drosophila, Fish, Guinea pig, Hamster, Monkey, Pig, Plant, Rabbit, Sheep, Xenopus |
| Conjugation | Unconjugated |
Rabbit polyclonal Hsp70 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Beluga, Cow, Dog, Fish (carp), Guinea Pig, Hamster, Monkey, Pig, Sheep, Coral, Tomato, Tobacco, Spiny Dogfish Shark (Squalus acanthias), Atlantic Hagfish (Myxine glutinosa) |
| Conjugation | Unconjugated |
| Immunogen | Full length human protein Hsp70 |
Rabbit Polyclonal Anti-NFYC Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NFYC antibody: synthetic peptide directed towards the C terminal of human NFYC. Synthetic peptide located within the following region: GTQVVQGQIQTLATNAQQITQTEVQQGQQQFSQFTDGQQLYQIQQVTMPA |
CD4 mouse monoclonal antibody, clone EDU-2, Aff - Purified
| Applications | FC, IHC |
| Reactivities | Human |
Active filters
Pathways
- Antigen processing and presentation
Filter by
Target Symbol
- CD4 (232)
- CD8A (68)
- HSPA1A (58)
- CTSL (54)
- RFXANK (47)
- PDIA3 (37)
- CALR (36)
- CREB1 (32)
- HSP90AB1 (29)
- CD74 (28)
- HSPA1L (27)
- B2M (26)
- HSP90AA1 (24)
- HSPA6 (22)
- HLA-A (18)
- SMURF2 (18)
- CANX (17)
- HSPA5 (16)
- HSPA8 (16)
- HLA-DQA2 (13)
- CIITA (11)
- KLRD1 (8)
- HLA-G (7)
- IFNA2 (7)
- KLRC1 (7)
- HLA-DRB5 (6)
- IFNA6 (6)
- PSME2 (6)
- CD8B (5)
- CTSB (5)
- CTSS (5)
- KIR2DL3 (5)
- NFYA (5)
- NFYC (5)
- PSME1 (5)
- TAPBP (5)
- HLA-B (4)
- HLA-DRA (4)
- HSPA4 (4)
- KIR3DL1 (4)
- LTA (4)
- NFYB (4)
- PSME3 (4)
- TAP2 (4)
- HLA-DMB (3)
- HLA-DRB3 (3)
- HLA-E (3)
- LGMN (3)
- RFX5 (3)
- HLA-DMA (2)
- HLA-DOA (2)
- HLA-DOB (2)
- HLA-DPA1 (2)
- HLA-DPB1 (2)
- HLA-F (2)
- IFI30 (2)
- IFNA16 (2)
- IFNA4 (2)
- KIR2DL1 (2)
- KIR2DL4 (2)
- RFXAP (2)
- TAP1 (2)
- HLA-C (1)
- HLA-DQA1 (1)
- HLA-DQB1 (1)
- HLA-DRB1 (1)
- HLA-DRB4 (1)
- HSPA1B (1)
- HSPA2 (1)
- IFNA1 (1)
- IFNA13 (1)
- IFNA17 (1)
- IFNA5 (1)
- IFNA7 (1)
- IFNA8 (1)
- KIR2DL5A (1)
- KIR3DL2 (1)
- KIR3DL3 (1)
- KLRC2 (1)
- KLRC3 (1)
- KLRC4 (1)
Reactivities
- Human (881)
- Mouse (336)
- Rat (335)
- Monkey (80)
- Dog (60)
- Bovine (24)
- Chicken (24)
- Rabbit (22)
- Hamster (21)
- Guinea Pig (14)
- Sheep (14)
- Canine (13)
- Drosophila (12)
- Pig (11)
- Xenopus (11)
- Fish (9)
- Cow (8)
- Porcine (8)
- Beluga (4)
- Primate (4)
- Amphibian (3)
- C. elegans (3)
- Chimpanzee (3)
- Fruit fly (3)
- Quail (3)
- Saccharomyces cerevisiae (3)
- Yeast (3)
- Carp (2)
- Fungus (2)
- Plant (2)
- Rhesus Monkey (2)
- Avian (1)
- Coral (1)
- Dogfish (1)
- Fungi (1)
- Hagfish (1)
- Insect (1)
- Tobacco (1)
- Tomato (1)
- Zebrafish (1)