Rabbit monoclonal antibody against CD13(clone EPR4058)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit monoclonal antibody against CD13(clone EPR4058)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal Cytochrome P450 8B1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 8B1. |
Rabbit anti-UGT1A1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human UGT1A1 |
Anti-EXT1 Rabbit Polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 280 amino acids of human exostosin glycosyltransferase 1 |
Rabbit anti-MAOB Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MAOB |
NT5E Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NT5E |
EXT1 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human EXT1 |
Rabbit anti-CYP2E1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CYP2E1 |
Rabbit Polyclonal Anti-DENR Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | DENR antibody was raised against an 18 amino acid peptide near the center of human DENR. |
Rabbit anti-SPAM1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SPAM1 |
Rabbit Polyclonal DPAGT1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | DPAGT1 antibody was raised against a 17 amino acid synthetic peptide near the amino terminus of human DPAGT1. |
Rabbit polyclonal anti-CHSY1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CHSY1. |
Rabbit polyclonal anti-NDUFA4L2 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDUFA4L2. |
TYR Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TYR |
USD 375.00
5 Days
Rabbit Polyclonal Anti-G6pc Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-G6pc antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DFGIQSTRYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLKETVGI |
Rabbit Polyclonal Anti-PPAP2A Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the middle region of human PPAP2A. Synthetic peptide located within the following region: DPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVAL |
Rabbit Polyclonal TCIRG1 Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Anti-ACER1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACER1 antibody: synthetic peptide directed towards the C terminal of human ACER1. Synthetic peptide located within the following region: VNAYALNSIALHILYIVCQEYRKTSNKELRHLIEVSVVLWAVALTSWISD |
Rabbit polyclonal anti-COX IV antibody, Loading control
Applications | IHC, WB |
Reactivities | Human, Mouse, Bovine, Primate, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of the human COX4-1 protein (within residues 1-100). [Swiss-Prot# P13073] |
Goat Polyclonal Antibody against TUSC3
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence PQRQCSVCRQAN, from the internal region of the protein sequence according to NP_006756.2; NP_839952.1. |
Rabbit Polyclonal p53R2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | p53R2 antibody was raised against a synthetic peptide corresponding to amino acids 2 to 17 of human p53R2 . |
Anti-HMGCR Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 260 amino acids of human 3-hydroxy-3-methylglutaryl-CoA reductase |
Rabbit anti-ANPEP Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ANPEP |
Rabbit Polyclonal Anti-AGPAT6 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human AGPAT6 |
Rabbit Polyclonal antibody to UGT1A9 (UDP glucuronosyltransferase 1 family, polypeptide A9)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 291 and 530 of UGT1A9 (Uniprot ID#O60656) |
Rabbit polyclonal anti-DCT (dopachrome tautomerase) antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DCT. |
Rabbit polyclonal anti-B4GALNT1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human B4GALNT1. |
Rabbit polyclonal anti-B4GALT1 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human B4GALT1. |
Rabbit polyclonal CYP1A2 Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This CYP1A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 255-282 amino acids from the Central region of human CYP1A2. |
Rabbit polyclonal EXT2 Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This EXT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 182-209 amino acids from the Central region of human EXT2. |
ABO Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ABO |
UGT1A9 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human UGT1A9 |
GGT1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GGT1 |
Rabbit anti-UGT2B7 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human UGT2B7 |
Rabbit anti-HSD3B2 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HSD3B2 |
Rabbit Polyclonal Anti-Cytochrome P450 2U1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Cytochrome P450 2U1 Antibody: A synthesized peptide derived from human Cytochrome P450 2U1 |
Goat Polyclonal Antibody against GCNT3 (aa 410 to 422)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-NKFDPKVDDNALQ, from the internal region (near C terminus) of the protein sequence according to NP_004742.1. |
Goat Polyclonal Antibody against B3GNT2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EKHKGFRTFDIE, from the internal region of the protein sequence according to NP_006568.2. |
Rabbit monoclonal antibody against INPP4A(clone EP3425(2))
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal antibody to GAL3ST1 (galactose-3-O-sulfotransferase 1)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 412 of GAL3ST1 (Uniprot ID#Q99999) |
Rabbit Polyclonal antibody to GALNT7 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 7 (GalNAc-T7))
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 24 and 515 of GALNT7 (Uniprot ID#Q86SF2) |
Rabbit polyclonal Cytochrome P450 2E1 antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human Cytochrome P450 2E1. |
Modifications | Phospho-specific |
Rabbit polyclonal anti-HSD11B1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human HSD11B1. |
Rabbit polyclonal anti-COX6C antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human COX6C. |
Rabbit polyclonal anti-BST1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human BST1. |
Rabbit polyclonal anti-GUSB antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GUSB. |
Rabbit polyclonal anti-NDUFA4 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDUFA4. |
Rabbit polyclonal anti-PTGIS antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human PTGIS. |
Rabbit polyclonal anti-B4GALT3 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human B4GALT3. |
Rabbit polyclonal anti-COX42 antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human COX42. |