Cytochrome P450 2A6 (CYP2A6) rabbit polyclonal antibody, Aff - Purified
Applications | IF, WB |
Reactivities | Human |
Immunogen | Synthetic peptide, corresponding to amino acids 101-150 of Human CYP2A6. |
Cytochrome P450 2A6 (CYP2A6) rabbit polyclonal antibody, Aff - Purified
Applications | IF, WB |
Reactivities | Human |
Immunogen | Synthetic peptide, corresponding to amino acids 101-150 of Human CYP2A6. |
DGAT2L4 (AWAT2) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 306-335 amino acids from the C-terminal region of human AWAT2 |
Goat Anti-DGAT2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KLEHPTQQDIDLYH, from the internal region (near the C Terminus) of the protein sequence according to NP_115953.2. |
Goat Polyclonal Antibody against cytochrome P450 2C8
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KNVALTRSYIREK, from the internal region of the protein sequence according to NP_000761.3; NP_001185782.1; NP_001185783.1. |
Rabbit polyclonal Cytochrome P450 3A4/5 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 3A4/5. |
Rabbit polyclonal CYP26C1 Antibody (C-term)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CYP26C1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 410-439 amino acids from the C-terminal region of human CYP26C1. |
Rabbit polyclonal Anti-UGT1A7 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT1A7 antibody: synthetic peptide directed towards the N terminal of human UGT1A7. Synthetic peptide located within the following region: VKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLFFSN |
Rabbit Polyclonal Anti-UGT1A1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT1A1 antibody: synthetic peptide directed towards the middle region of human UGT1A1. Synthetic peptide located within the following region: ASVWLFRSDFVKDYPRPIMPNMVFVGGINCLHQNPLSQEFEAYINASGEH |
Rabbit Polyclonal DGAT2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of the human DGAT2 protein (within residues 200-300). [Swiss-Prot Q96PD7] |
Rabbit Polyclonal Anti-RDH10 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RDH10 antibody: synthetic peptide directed towards the N terminal of human RDH10. Synthetic peptide located within the following region: QSNEETAGMVRHIYRDLEAADAAALQAGNGEEEILPHCNLQVFTYTCDVG |
Rabbit Polyclonal Anti-CYP2A6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP2A6 antibody is: synthetic peptide directed towards the C-terminal region of Human CYP2A6. Synthetic peptide located within the following region: MEAVIHEIQRFGDVIPMSLARRVKKDTKFRDFFLPKGTEVYPMLGSVLRD |
Mouse monoclonal Anti-Cytochrome P450 1A1 and 1A2 Clone MC1
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 1,140.00
9 Weeks
Mouse monoclonal Anti-Cytochrome P450 2A6, 2A7, 2A13 Clone F16 P2 D8
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 1,140.00
9 Weeks
Mouse monoclonal Anti-Cytochrome P450 3A4 Clone F24 P2 B10
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 1,140.00
9 Weeks
Mouse monoclonal Anti-Cytochrome P450 1A2 Clone 3B8C1
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse monoclonal Anti-Cytochrome P450 26A1 Clone F27P6A1
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 1,140.00
2 Weeks
Mouse monoclonal Anti-Cytochrome P450 3A5 Clone F18P3B6
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse monoclonal Anti-Cytochrome P450 3A7 Clone F19P2H2
Applications | IHC, WB |
Reactivities | Human |
USD 1,140.00
9 Weeks
Mouse monoclonal Anti-Cytochrome P450 4A11 Clone M25-P2A10
Applications | IHC, WB |
Reactivities | Drosophila, Human, Mouse, Rat, Xenopus |
Conjugation | Unconjugated |
USD 379.00
2 Weeks
CYP1A2 Capture mouse monoclonal antibody, ELISA validated, clone OTI7A9
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700038 |
UGT2B17 (Center) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human UDB17 |
CYP2A13 (C-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human CYP2A13 |
Cytochrome P450 3A5 (CYP3A5) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human CYP3A5 |
CYP26A1 (485-496) goat polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human |
Immunogen | Synthetic peptide from an internal region of human CYP26A1 (NP_000774.2; NP_476498.1) |
DGAT2 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of Human DGAT2. |
DHRS3 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 92~121 amino acids from the Center region of human DHRS3 |
Rabbit Polyclonal antibody to UGT2B7 (UDP glucuronosyltransferase 2 family, polypeptide B7)
Reactivities | Human |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 278 of UGT2B7 (Uniprot ID#P16662) |
Rabbit Polyclonal DGAT1 Antibody
Applications | WB |
Reactivities | Bovine, Goat, Human, Mouse, Primate, Rat, Sheep, Zebrafish |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide within an internal region (residues 200-300) of the human DGAT1 protein. [Swiss-Prot# O75907] |
Rabbit polyclonal Cytochrome P450 3A43 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 3A43. |
Rabbit polyclonal anti-CP26C antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human CP26C. |
Rabbit polyclonal anti-DGAT1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to residues surrounding amino acids 308 of mouse DGAT-1 |
Rabbit Polyclonal anti-UGT1A9 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT1A9 antibody: synthetic peptide directed towards the N terminal of human UGT1A9. Synthetic peptide located within the following region: LLMGSYNDIFDLFFSNCRSLFKDKKLVEYLKESSFDAVFLDPFDNCGLIV |
Goat Anti-cytochrome P450 1A1 Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CQEKQLDENANVQ, from the internal region of the protein sequence according to NP_000490.1 |
Rabbit polyclonal Anti-UGT1A5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT1A5 antibody: synthetic peptide directed towards the N terminal of human UGT1A5. Synthetic peptide located within the following region: EENFFTLTTYAISWTQDEFDRLLLGHTQSFFETEHLLMKFSRRMAIMNNM |
Rabbit Polyclonal Anti-DGAT2L4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DGAT2L4 antibody: synthetic peptide directed towards the C terminal of human DGAT2L4. Synthetic peptide located within the following region: GEPLPMPKIENPSQEIVAKYHTLYIDALRKLFDQHKTKFGISETQELEII |
Rabbit Polyclonal Anti-UGT2B4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT2B4 antibody: synthetic peptide directed towards the N terminal of human UGT2B4. Synthetic peptide located within the following region: NIKTILDELVQRGHEVTVLASSASISFDPNSPSTLKFEVYPVSLTKTEFE |
Rabbit Polyclonal Anti-CYP3A43 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP3A43 antibody: synthetic peptide directed towards the middle region of human CYP3A43. Synthetic peptide located within the following region: ERMKESRLKDKQKHRVDFFQQMIDSQNSKETKSHKALSDLELVAQSIIII |
Rabbit Polyclonal Anti-CYP3A43 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP3A43 antibody: synthetic peptide directed towards the C terminal of human CYP3A43. Synthetic peptide located within the following region: IYALHHDPKYWTEPEKFCPESRFSKKNKDSIDLYRYIPFGAGPRNCIGMR |
Rabbit Polyclonal Anti-UGT2A3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT2A3 antibody: synthetic peptide directed towards the N terminal of human UGT2A3. Synthetic peptide located within the following region: NVKVILEELIVRGHEVTVLTHSKPSLIDYRKPSALKFEVVHMPQDRTEEN |
Rabbit Polyclonal Anti-UGT2A3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT2A3 antibody: synthetic peptide directed towards the middle region of human UGT2A3. Synthetic peptide located within the following region: GIVVFSLGSLFQNVTEEKANIIASALAQIPQKVLWRYKGKKPSTLGANTR |
Rabbit Polyclonal Anti-CYP3A4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP3A4 antibody: synthetic peptide directed towards the middle region of human CYP3A4. Synthetic peptide located within the following region: KSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSI |
Rabbit Polyclonal Anti-CYP3A4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP3A4 antibody: synthetic peptide directed towards the middle region of human CYP3A4. Synthetic peptide located within the following region: MIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIG |
Rabbit Polyclonal Anti-UGT1A4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT1A4 antibody: synthetic peptide directed towards the N terminal of human UGT1A4. Synthetic peptide located within the following region: VVLTPEVNMHIKEEKFFTLTAYAVPWTQKEFDRVTLGYTQGFFETEHLLK |
Rabbit Polyclonal Anti-TMEM158 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TMEM158 antibody: synthetic peptide directed towards the middle region of human TMEM158. Synthetic peptide located within the following region: AHGRAFFAAAFHRVGPPLLIEHLGLAAGGAQQDLRLCVGCGWVRGRRTGR |
Rabbit Polyclonal Anti-CYP2A6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP2A6 antibody: synthetic peptide directed towards the C terminal of human CYP2A6. Synthetic peptide located within the following region: AFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKDIDVSPKH |
Rabbit Polyclonal Anti-DGAT1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Dgat1 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Dgat1. Synthetic peptide located within the following region: HRLQDSLFSSDSGFSNYRGILNWCVVMLILSNARLFLENLIKYGILVDPI |
Rabbit polyclonal anti-Cytochrome P450 (CYP1A1,CYP1A2) antibody
Reactivities | Rat |
Immunogen | Cytochrome P450 (CYP1A1,CYP1A2) |
Rabbit polyclonal anti-Cytochrome P450 (CYP1A1) antibody
Reactivities | Rat |
Immunogen | Cytochrome P450 (CYP1A1) |
USD 1,140.00
2 Weeks
Mouse monoclonal Anti-CYP1A2 Clone D15
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal anti-Cytochrome P450 (CYP1A2) antibody
Reactivities | Human |
Immunogen | Cytochrome P450 (CYP1A2) |