Germany
Japan
United Kingdom
China
TRAIL (TNFSF10) mouse monoclonal antibody, clone B-S23, Azide Free
| Applications | FC, FN |
| Reactivities | Human |
Antibodies
View as table DownloadDcR2 (TNFRSF10D) mouse monoclonal antibody, clone B-P30, Azide Free
| Applications | IP, WB |
| Reactivities | Human |
BAX rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
Fas Ligand (FASLG) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | FASLG antibody was raised against peptide mapping near the amino terminus of rat FAS-L |
Fas Ligand (FASLG) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to a sequence mapping at the C-terminal of human FAS-L |
DR5 (TNFRSF10B) rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (>98%) 14,9 kDa recombinant Human soluble TRAIL Receptor-2. |
DR5 (TNFRSF10B) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Immunogen | Highly pure (>98%) recombinant Human soluble TRAIL Receptor-2. |
DR5 (TNFRSF10B) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Immunogen | Highly pure (>98%) recombinant Human soluble TRAIL Receptor-2. |
Rabbit Polyclonal AIF Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | AIF antibody was raised against a peptide corresponding to amino acids near the amino terminus of mature human AIF. The immunogen is located within amino acids 90 - 140 of AIF. |
Bcl-2 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Immunogen | BCL2 / Bcl-2 antibody was raised against synthetic peptide from human BCL-2 (aa46-95). |
Rabbit polyclonal Phospho-bcl-2(S70) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This bcl-2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S70 of human bcl-2. |
| Modifications | Phospho-specific |
Rabbit Polyclonal BCL-2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human BCL-2 |
Rabbit Polyclonal Trk A (Tyr680+Tyr681) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Trk A around the phosphorylation site of Tyrosine 680+Tyrosine 681 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-AIFM1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDCD8 antibody: synthetic peptide directed towards the N terminal of human PDCD8. Synthetic peptide located within the following region: GAYAYKTMKEDEKRYNERISGLGLTPEQKQKKAALSASEGEEVPQDKAPS |
Rabbit Polyclonal Anti-TNFRSF1A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TNFRSF1A antibody: synthetic peptide directed towards the N terminal of human TNFRSF1A. Synthetic peptide located within the following region: MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYI |
Rabbit anti CD253/TRAIL/ (TNFSF10) (IN1) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the N-terminus of TRAIL protein (from 115aa-140aa). This sequence is identical to human and mouse. |
DcR1 (TNFRSF10C) mouse monoclonal antibody, clone TRAIL-R3-02, FITC
| Applications | FC |
| Reactivities | Human |
| Conjugation | FITC |
DcR1 (TNFRSF10C) mouse monoclonal antibody, clone TRAIL-R3-02, PE
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
DcR2 (TNFRSF10D) mouse monoclonal antibody, clone TRAIL-R4-01, FITC
| Applications | FC |
| Reactivities | Human |
| Conjugation | FITC |
DcR2 (TNFRSF10D) mouse monoclonal antibody, clone TRAIL-R4-01, PE
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, Biotin
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Biotin |
TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, HRP
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | HRP |
BCL2 (41-54) mouse monoclonal antibody, clone Bcl2/100, FITC
| Applications | FC |
| Reactivities | Human |
| Conjugation | FITC |
BCL2 (41-54) mouse monoclonal antibody, clone Bcl2/100, PE
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
DcR1 (TNFRSF10C) mouse monoclonal antibody, clone B-H47, Azide Free
| Applications | WB |
| Reactivities | Human |
CD95 (FAS) mouse monoclonal antibody, clone B-G27, FITC
| Applications | FC |
| Reactivities | Human |
| Conjugation | FITC |
CD95 (FAS) mouse monoclonal antibody, clone B-G27, PE
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
Fas Ligand (FASLG) mouse monoclonal antibody, clone B-R17, Biotin
| Applications | FC |
| Reactivities | Human |
| Conjugation | Biotin |
TRAIL (TNFSF10) mouse monoclonal antibody, clone B-S23, Biotin
| Applications | FC |
| Reactivities | Human |
| Conjugation | Biotin |
TRAIL (TNFSF10) mouse monoclonal antibody, clone B-S23, Purified
| Applications | FC |
| Reactivities | Human |
Active filters
Families
- Transmembrane
Pathways
- Apoptosis