Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Anti-HLA-DRA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 26-216 amino acids of human major histocompatibility complex, class II, DR alpha |
HLA-DRA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HLA-DRA |
CD40 (C-term) rabbit polyclonal antibody, Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | CD40 antibody was raised against a synthetic peptide derived from C-terminal of human CD40 |
Rabbit polyclonal anti-HLA-DOB antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human HLA-DOB. |
Rabbit polyclonal anti-IL-13 antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | E. coli expressed recombinant mouse IL-13 |
Mouse Anti-Human CD40 Purified (100 ug)
| Reactivities | Human |
| Conjugation | Unconjugated |
HLA-DRB3 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HLA-DRB3 |
Rabbit anti-FCER1A Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FCER1A |
Rabbit Polyclonal Anti-CD40LG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD40LG antibody: synthetic peptide directed towards the middle region of human CD40LG. Synthetic peptide located within the following region: ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN |
Rabbit Polyclonal Anti-CD40 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: SQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCD |
Rabbit Polyclonal Anti-CD40 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: WNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV |
Goat Polyclonal Anti-TNF alpha Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant human TNF-_ produced in E. coli. |
Mouse Monoclonal Anti-TNF Antibody, Biotinylated
| Applications | E |
| Reactivities | Human, Monkey |
| Conjugation | Biotin |
TNF alpha (TNF) mouse monoclonal antibody, clone Mab1, Purified
| Applications | ELISA, FN, WB |
| Reactivities | Human |
Rabbit polyclonal anti-HLA-DOA antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human HLA-DOA. |
Rabbit polyclonal anti-HA2Q antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human HA2Q. |
Mouse Anti-Human HLA-DR Purified (100 ug)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Anti-Human TNF alpha Purified (50 ug)
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal TNFA Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human TNFA |
TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 440.00
2 Weeks
TNF alpha (TNF) mouse monoclonal antibody, clone 2C8, Aff - Purified
| Applications | ELISA, FN |
| Reactivities | Human |
IL13 mouse monoclonal antibody, clone B-B13, Azide Free
| Applications | FC, FN |
| Reactivities | Human |
CD40L (CD40LG) (C-term) rabbit polyclonal antibody
| Applications | FC, WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human TRAP |
Rabbit Polyclonal Anti-IL-13 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | For immunization recombinant human IL-13 (E.coli-derived) is used |
TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, Biotin
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Biotin |
TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, HRP
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | HRP |
Active filters
Category
-
Antibodies
- Primary Antibodies
Families
- Transmembrane
Pathways
- Asthma