IL-8 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone SNAP8
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700024 |
IL-8 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone SNAP8
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700024 |
EGFR L858R mouse monoclonal antibody,clone UMAB233
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EGFR L858R mouse monoclonal antibody,clone UMAB233
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ATP6V0A2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ATP6V0A2 antibody: synthetic peptide directed towards the N terminal of human ATP6V0A2. Synthetic peptide located within the following region: INRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRKN |
Rabbit polyclonal EGFR (Ab-1172) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal TACE Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TACE antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human TACE This sequence differs from those of mouse and rat TACE by one amino acid. |
RANTES (CCL5) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to amino acids 50-100 of Human RANTES. |
Mouse Monoclonal IL8 Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal TCIRG1 Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit polyclonal IL8 Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This IL8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-99 amino acids from the C-terminal region of human IL8. |
ADAM17 mouse monoclonal antibody, clone 1F6
Applications | ELISA, IF, IHC, PLA, WB |
Reactivities | Human |
MET pTyr1234 rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal antibody to JAM-B (junctional adhesion molecule 2)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 294 of JAM-B (Uniprot ID#P57087) |
Rabbit polyclonal IL-8R beta/CDw128 beta (Ser347) antibody(Phospho-specific)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IL-8R beta/CDw128 beta around the phosphorylation site of serine 347 (R-P-SP-F-V). |
Modifications | Phospho-specific |
CCL5 / RANTES Mouse Monoclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti-ATP6AP1 Polyclonal Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ATP6AP1 |
F11R Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human F11R |
Rabbit anti-CCL5 Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CCL5 |
Rabbit Polyclonal Anti-Interleukin 8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Interleukin 8 Antibody: A synthesized peptide derived from human Interleukin 8 |
USD 530.00
2 Weeks
EGFR Non pTyr1197 (incl. pos. control) mouse monoclonal antibody, clone 20G3, Biotin
Applications | ELISA, IF, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Biotin |
USD 340.00
2 Weeks
EGFR (Extracell. non Ligand binding Site) mouse monoclonal antibody, clone EGF-R2, Purified
Applications | Assay, ELISA, FC, IHC |
Reactivities | Human |
USD 125.00
2 Weeks
EGFR (Extracell. non Ligand binding Site) mouse monoclonal antibody, clone EGF-R2, Purified
Applications | Assay, ELISA, FC, IHC |
Reactivities | Human |
EGFR sheep polyclonal antibody, Purified
Applications | IF, IHC, IP, WB |
Reactivities | Chicken, Human, Mouse, Rat |
Immunogen | Synthetic 20 amino acid peptide of human EGFr representing a portion of the internal domain proximal to a phosphorylation region |
Rabbit polyclonal c-Met (Ab-1003) antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human c-Met around the phosphorylation site of tyrosine 1003 (V-D-YP-R-A). |
Modifications | Phospho-specific |
Rabbit polyclonal c-Met (Tyr1003) antibody(Phospho-specific)
Applications | IF, IHC, WB |
Reactivities | Human: Tyr1003, Mouse: Tyr1001, Rat: Tyr1004 |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human c-Met around the phosphorylation site of tyrosine 1003 (V-D-YP-R-A). |
Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Thr693) antibody(Phospho-specific)
Applications | IF, IHC, WB |
Reactivities | Human: Thr693, Mouse: Thr695, Rat: Thr694 |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of threonine 693 (P-L-TP-P-S). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-PTPRZ1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human PTPRZ1. |
Mouse monoclonal MET/HGFR Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Anti-Human IL-8 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IL-8 (72 a.a.) (CXCL8) |
Rabbit Polyclonal Anti-CXCR1 (extracellular)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide (C)SNITDPQMW DFDDLN, corresponding to aminoacid residues 2-16 of human CXCR1. Extracellular, N-terminus. |
Rabbit Polyclonal Anti-IL8RB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IL8RB antibody: synthetic peptide directed towards the N terminal of human IL8RB. Synthetic peptide located within the following region: MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYF |
Rabbit Polyclonal Anti-EGFR Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EGFR Antibody: A synthesized peptide derived from human EGFR |
Rabbit Polyclonal Anti-MET Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MET |
purified EGFR Capture mouse monoclonal antibody, Luminex validated, clone OTI1B10
Applications | LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700469 |
purified EGFR Capture mouse monoclonal antibody, Luminex validated, clone OTI2E1
Applications | LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700471 |
purified EGFR Capture mouse monoclonal antibody, Luminex validated, clone OTI3D7
Applications | LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700469 |
purified EGFR Capture mouse monoclonal antibody, Luminex validated, clone OTI3F2
Applications | LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700472 |
purified EGFR Capture mouse monoclonal antibody, Luminex validated, clone OTI11H7
Applications | LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700473 |
EGFR L858R mouse monoclonal antibody,clone UMAB233
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Goat Polyclonal Anti-ERBB1 Antibody
Applications | WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 1,162 aa to the C-terminus of human ERBB1 produced in E. coli. |
USD 530.00
2 Weeks
EGFR pTyr1069 (incl. pos. control) mouse monoclonal antibody, clone 11C2, Biotin
Applications | ELISA, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Biotin |
IL8 (CXCL8) mouse monoclonal antibody, clone I8-61, Azide Free
Applications | ELISA, FN, WB |
Reactivities | Human |
Conjugation | Unconjugated |
IL8 (CXCL8) mouse monoclonal antibody, clone 257, Azide Free
Applications | ELISA, FN, WB |
Reactivities | Human |
Conjugation | Unconjugated |
IL8 (CXCL8) mouse monoclonal antibody, clone 807, Azide Free
Applications | ELISA, FN, WB |
Reactivities | Human |
Conjugation | Unconjugated |
EGFR pTyr1016 mouse monoclonal antibody, clone EM-12, Purified
Applications | FC, IP, WB |
Reactivities | Human |
EGFR pTyr1197 mouse monoclonal antibody, clone EM-13, Purified
Applications | FC, IP, WB |
Reactivities | Human |
USD 355.00
2 Weeks
EGFR (Ligand binding Site) mouse monoclonal antibody, clone EGF-R1, Purified
Applications | ELISA, FC, IHC |
Reactivities | Human |
EGFR (Ligand bdg. Dom.) mouse monoclonal antibody, clone EGF-R1, Purified
Applications | ELISA, FC, IHC |
Reactivities | Human |
USD 480.00
2 Weeks
Junctional Adhesion Molecule 2 (JAM2) (29-299) mouse monoclonal antibody, clone 1G4, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
EGFR mouse monoclonal antibody, clone AT2H8, Purified
Applications | ELISA, IF, WB |
Reactivities | Human |