USD 399.00
In Stock
CD19 mouse monoclonal antibody,clone 3B10, DyLight 488 conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | DyLight 488 |
USD 399.00
In Stock
CD19 mouse monoclonal antibody,clone 3B10, DyLight 488 conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | DyLight 488 |
CD19 mouse monoclonal antibody,clone 3B10, PE conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | PE |
Rabbit Polyclonal Antibody against CD19 (N-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CD19 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 143-172 amino acids from the N-terminal region of human CD19. |
Goat Polyclonal Anti-CD45 Antibody
Applications | WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 1,260 aa to the C-terminus of human CD45 produced in E. coli. |
Rabbit anti-IL7R Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human IL7R |
Goat Polyclonal Anti-CD19 Antibody
Applications | WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide within residues 510 aa to the C-terminus of human CD19 produced in E. coli. |
CD4 mouse monoclonal antibody, clone B-A1, Azide Free
Applications | FC, FN, IHC |
Reactivities | Human |
Rabbit Polyclonal CD4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Rabbit |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
CD40L Capture mouse monoclonal antibody, ELISA and Luminex validated, clone MK13A4
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700027 |
TAP2 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TAP2 |
Goat Polyclonal Anti-CD4 Antibody
Applications | WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within 50 to 235 aa, corresponding to the external domain of human CD4 produced in E. coli. |
CD45 (PTPRC) (CD45RC) mouse monoclonal antibody, clone MT2, Aff - Purified
Applications | FC, IF, IHC |
Reactivities | Human |
ICOS Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ICOS |
Rabbit Monoclonal Antibody against CD8A (Clone EP1150Y)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against CD8A (N-term)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 59-88 amino acids from the N-terminal region of human CD8A. |
CD4 mouse monoclonal antibody, clone EDU-2, Aff - Purified
Applications | FC, IHC |
Reactivities | Human |
Rabbit polyclonal anti-CD40 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human CD40. |
CD3E mouse monoclonal antibody, clone UCHT1, Azide Free
Applications | FC, FN, IHC, IP |
Reactivities | Human, Monkey |
CD8A mouse monoclonal antibody, clone CT6, Supernatant
Applications | FC, IHC |
Reactivities | Guinea Pig |
Rabbit anti-CD3E Polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CD3E |
CD19 Capture mouse monoclonal antibody, Luminex validated, clone OTI3G7
Applications | LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700283 |
USD 240.00
2 Weeks
CD3E (activation epitope) mouse monoclonal antibody, clone APA1/1, Aff - Purified
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse |
CD19 mouse monoclonal antibody, clone HD37, Aff - Purified
Applications | FC, IHC |
Reactivities | Human |
CD4 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide corresponding to amino acids 391-440 of Human CD4. |
CD40L (CD40LG) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to a sequence at the N-terminal of human CD40L |
IL2 Receptor gamma (IL2RG) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 76 - 101 amino acids from the N-terminal region of Human CD132 / IL2RG |
Rabbit anti-CD19 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CD19 |
CD3E mouse monoclonal antibody, clone OKT3, Low Endotoxin
Applications | FC, FN, IHC |
Reactivities | Human |
CD40 mouse monoclonal antibody, clone B-B20, Azide Free
Applications | FC, FN, IHC |
Reactivities | Human |
CD40L (CD40LG) mouse monoclonal antibody, clone B-B29, Azide Free
Applications | FC, IHC |
Reactivities | Human |
CD40 (C-term) rabbit polyclonal antibody, Purified
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | CD40 antibody was raised against a synthetic peptide derived from C-terminal of human CD40 |
Rabbit Polyclonal BAFF Receptor Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | BAFF Receptor antibody was raised against a synthetic peptide corresponding to amino acids near the carboxy terminus of human BAFF Receptor The peptide sequence is identical between human and mouse origin. |
Rabbit polyclonal IL-7R/CD127 (Tyr449) antibody(Phospho-specific)
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IL-7R/CD127 around the phosphorylation site of tyrosine 449 (E-A-YP-V-T). |
Modifications | Phospho-specific |
Mouse Anti-Human CD40 Purified (100 ug)
Reactivities | Human |
Conjugation | Unconjugated |
Rat Anti-Human/Mouse CD45R (B220) Purified (100 ug)
Applications | FC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal CD19 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CD19 |
Rabbit Polyclonal CD19 (Tyr531) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CD19 around the phosphorylation site of Tyrosine 531 |
Modifications | Phospho-specific |
Rabbit anti-IL2RG Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human IL2RG |
Rabbit Polyclonal Anti-CD40LG Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD40LG antibody: synthetic peptide directed towards the middle region of human CD40LG. Synthetic peptide located within the following region: ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN |
Rabbit Polyclonal Anti-CD40 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: SQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCD |
Rabbit Polyclonal Anti-CD40 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: WNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV |
Rabbit Polyclonal Anti-CD8B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD8B antibody: synthetic peptide directed towards the N terminal of human CD8B. Synthetic peptide located within the following region: RIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFI |
Rabbit Polyclonal Anti-CD8B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD8B antibody: synthetic peptide directed towards the middle region of human CD8B. Synthetic peptide located within the following region: KPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCR |
Rabbit Polyclonal Anti-CD8A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD8A Antibody: A synthesized peptide derived from human CD8A |
Rabbit Polyclonal Anti-CD8B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD8B Antibody: A synthesized peptide derived from human CD8B |
Goat Polyclonal Anti-CD4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CD4 Antibody: Peptide with sequence C-KNKEVSVKRVTQDPK, from the internal region of the protein sequence according to NP_000607.1; NP_001181943.1. |
Mouse Monoclonal Anti-CD4 Antibody [9H5A8]
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-CD4 Antibody [8G1B12]
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal CD4 Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Goat Polyclonal Anti-CD19 Antibody
Applications | WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide within residues 510 aa to the C-terminus of human CD19 produced in E. coli. |