Germany
Japan
United Kingdom
China
Antibodies
View as table Download
USD 524.00
In Stock
BAX (3-16) mouse monoclonal antibody, clone 2D2, Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Monkey |
BAX (3-16) mouse monoclonal antibody, clone 2D2, Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Monkey |
Prion protein PrP (PRNP) mouse monoclonal antibody, clone EM-20, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
CCL5 / RANTES Mouse Monoclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti-CCL5 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CCL5 |
Mouse Monoclonal anti-Bax Antibody
| Applications | IP |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-Bax Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Bax Antibody: A synthesized peptide derived from human Bax |
Rabbit polyclonal Bax (Thr167) antibody(Phospho-specific)
| Applications | IF |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Bax around the phosphorylation site of threonine 167 (F-G-TP-P-T). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Prion protein Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
BAX rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
Anti-NCAM1 (CD56) Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa.850~854(Q-T-K-E-N)derived from Human CD56(NCAM). |
Rabbit Polyclonal Anti-C8B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C8B antibody: synthetic peptide directed towards the middle region of human C8B. Synthetic peptide located within the following region: WKPGSSGPGSTGSWNSGSSGTGSTGNQNPGSPRPGSTGTWNPGSSERGSA |
Rabbit Polyclonal Anti-C8B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C8B antibody: synthetic peptide directed towards the C terminal of human C8B. Synthetic peptide located within the following region: SGSTTTTRRSCSKTVTKTVIGPDGHKEVTKEVVTSEDGSDCPEAMDLGTL |
Rabbit Polyclonal Anti-CCL5 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCL5 antibody: synthetic peptide directed towards the middle region of mouse CCL5. Synthetic peptide located within the following region: YGSDTTPCCFAYLSLELPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCAN |
CD56 (NCAM1) mouse monoclonal antibody, clone B-A19, Azide Free
| Applications | FC |
| Reactivities | Human |
CD56 (NCAM1) mouse monoclonal antibody, clone B-A19, Purified
| Applications | FC |
| Reactivities | Human |
CD56 (NCAM1) mouse monoclonal antibody, clone B-A19, PE
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
NCAM2 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
CD56 (NCAM1) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | A synthetic peptide corresponding to the C-teminal end of human CD56 |
BAX (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rabbit, Rat |
| Immunogen | Synthetic peptide corresponding to a sequence mapping near the N-terminal of human BAX |
Goat Polyclonal Antibody against Prion Protein (143-153)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SDYEDRYYREN, from the internal region of the protein sequence according to NP_000302.1; NP_898902.1. |
Rabbit polyclonal anti-BAX antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human BAX. |
Mouse Monoclonal anti-Bax Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Prion protein Antibody
| Applications | WB |
| Reactivities | Bovine, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Amino acids 142-148 of BSE protein were used as the immunogen. |
Rabbit Polyclonal Prion protein Antibody
| Applications | WB |
| Reactivities | Bovine, Sheep, Avian |
| Conjugation | Unconjugated |
| Immunogen | Amino acids 162-170 of BSE protein were used as the immunogen. |
Rabbit Polyclonal Prion protein Antibody
| Applications | WB |
| Reactivities | Bovine, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Amino acids 217-229 of BSE protein were used as the immunogen. |
Rabbit Polyclonal Anti-NCAM2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NCAM2 antibody: synthetic peptide directed towards the middle region of human NCAM2. Synthetic peptide located within the following region: KGQGDYSKIEIFQTLPVREPSPPSIHGQPSSGKSFKLSITKQDDGGAPIL |
Rabbit Polyclonal Anti-PRNP Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Prnp antibody is: synthetic peptide directed towards the middle region of Mouse Prnp. Synthetic peptide located within the following region: GGGTHNQWNKPSKPKTNLKHVAGAAAAGAVVGGLGGYMLGSAMSRPMIHF |
Mouse Monoclonal Bax Antibody
| Applications | WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
Mouse Monoclonal Bax Antibody
| Applications | WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-NCAM Clone ERIC-1
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti BAX Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to N-term of human BAX protein. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Families
- Transmembrane
Pathways
- Prion diseases