Antibodies

Jump to Filters
View as table Download
Squalene Epoxidase (SQLE) Rabbit Polyclonal Antibody
TA346342

USD 475.00

5 Days

Rabbit Polyclonal Anti-SQLE Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SQLE antibody: synthetic peptide directed towards the C terminal of human SQLE. Synthetic peptide located within the following region: KKSFYWARKTSHSFVVNILAQALYELFSATDDSLHQLRKACFLYFKLGGE
CYP51A1 Rabbit Polyclonal Antibody
TA342862

USD 375.00

5 Days

Rabbit Polyclonal Anti-CYP51A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP51A1 antibody: synthetic peptide directed towards the N terminal of human CYP51A1. Synthetic peptide located within the following region: TYLLGSDAAALLFNSKNEDLNAEDVYSRLTTPVFGKGVAYDVPNPVFLEQ
Squalene Epoxidase (SQLE) (N-term) Rabbit Polyclonal Antibody
AP54036PU-N

USD 450.00

2 Weeks

Squalene Epoxidase (SQLE) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 67-97aa) of human Squalene epoxidase / SQLE
CYP51A1 Mouse Monoclonal Antibody [Clone ID: N6-P2H5*G8]
TA353141L

USD 1,140.00

2 Weeks

Mouse monoclonal Anti-Cytochrome P450 51A1 Clone N6-P2H5*G8

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
SC5DL (SC5D) Rabbit Polyclonal Antibody
TA336055

USD 375.00

5 Days

Rabbit Polyclonal Anti-SC5DL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SC5DL Antibody: synthetic peptide directed towards the N terminal of human SC5DL. Synthetic peptide located within the following region: NQVRREIKFTVQALPWISILTVALFLLEIRGYSKLHDDLGEFPYGLFELV
emopamil binding protein (EBP) Rabbit Polyclonal Antibody
TA341847

USD 375.00

5 Days

Rabbit Polyclonal Anti-EBP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EBP antibody: synthetic peptide directed towards the N terminal of human EBP. Synthetic peptide located within the following region: LVIEGWFVLYYEDLLGDQAFLSQLWKEYAKGDSRYILGDNFTVCMETITA
C 4 Methylsterol Oxidase (MSMO1) Rabbit Polyclonal Antibody
TA341859

USD 310.00

5 Days

Rabbit Polyclonal Anti-SC4MOL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SC4MOL antibody: synthetic peptide directed towards the N terminal of human SC4MOL. Synthetic peptide located within the following region: MATNESVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNNYTKFQIA
Seladin 1 (DHCR24) Rabbit Polyclonal Antibody
TA341955

USD 375.00

5 Days

Rabbit Polyclonal Anti-DHCR24 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DHCR24 antibody: synthetic peptide directed towards the N terminal of human DHCR24. Synthetic peptide located within the following region: FLLPLSLIFDIYYYVRAWVVFKLSSAPRLHEQRVRDIQKQVREWKEQGSK
Seladin 1 (DHCR24) Rabbit Polyclonal Antibody
TA341956

USD 375.00

5 Days

Rabbit Polyclonal Anti-DHCR24 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DHCR24 antibody: synthetic peptide directed towards the middle region of human DHCR24. Synthetic peptide located within the following region: AELYIDIGAYGEPRVKHFEARSCMRQLEKFVRSVHGFQMLYADCYMNREE
NSDHL Rabbit Polyclonal Antibody
TA341986

USD 310.00

5 Days

Rabbit Polyclonal Anti-NSDHL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NSDHL antibody: synthetic peptide directed towards the middle region of human NSDHL. Synthetic peptide located within the following region: RAVLGANDPEKNFLTTAIRPHGIFGPRDPQLVPILIEAARNGKMKFVIGN
SOAT 2 (SOAT2) Mouse Monoclonal Antibody [Clone ID: OTI2E12]
CF800765

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SOAT2 mouse monoclonal antibody,clone OTI2E12

Applications IHC
Reactivities Human
Conjugation Unconjugated
SOAT 2 (SOAT2) Mouse Monoclonal Antibody [Clone ID: OTI2D3]
CF800775

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SOAT2 mouse monoclonal antibody,clone OTI2D3

Applications IHC
Reactivities Human
Conjugation Unconjugated
DHCR7 Rabbit Polyclonal Antibody
TA349889

USD 345.00

In Stock

Rabbit Polyclonal Anti-DHCR7 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human DHCR7
Seladin 1 (DHCR24) Rabbit Polyclonal Antibody
TA350394

USD 345.00

In Stock

Rabbit Polyclonal Anti-DHCR24 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human DHCR24
C 4 Methylsterol Oxidase (MSMO1) Rabbit Polyclonal Antibody
TA351165

USD 345.00

In Stock

Rabbit Polyclonal Anti-MSMO1 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human MSMO1
TM7SF2 Rabbit Polyclonal Antibody
TA351818

USD 345.00

In Stock

Rabbit Polyclonal Anti-TM7SF2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human TM7SF2
SOAT 1 (SOAT1) Rabbit Polyclonal Antibody
TA356528

USD 360.00

5 Days

SOAT1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SOAT1
TM7SF2 Rabbit Polyclonal Antibody
TA356543

USD 360.00

5 Days

TM7SF2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TM7SF2