Germany
Japan
United Kingdom
China
Antibodies
View as table Download
CD16 (FCGR3A) mouse monoclonal antibody, clone DJ130c, Purified
| Applications | FC, IHC |
| Reactivities | Human |
Rabbit Anti-NMDA NR2B Subunit Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein from the C-terminal region of the NR2B subunit |
USD 300.00
In Stock
Integrin alpha E (ITGAE) mouse monoclonal antibody, clone B-ly7, Aff - Purified
| Applications | FC, IHC |
| Reactivities | Human |
Anti-HLA-DRA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 26-216 amino acids of human major histocompatibility complex, class II, DR alpha |
CD28 mouse monoclonal antibody, clone CD28.2, Azide Free
| Applications | FC, FN, IF, IHC, IP, WB |
| Reactivities | Human, Primate |
Neutrophil Elastase sheep polyclonal antibody, Ion exchange chromatography
| Applications | ELISA, Ie, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Neutrophil elastase (active-site blocked) prepared from human sputum. |
AP23184PU-N is a possible alternative to AP00714PU-N.
CD28 mouse monoclonal antibody, clone CD28.2, Purified
| Applications | FC, FN, IF, IHC, IP, WB |
| Reactivities | Human, Primate |
CD16 (FCGR3A) mouse monoclonal antibody, clone c127, Aff - Purified
| Applications | FC, IHC, IP |
| Reactivities | Human |
Integrin alpha E (ITGAE) mouse monoclonal antibody, clone B-ly7, FITC
| Applications | FC |
| Reactivities | Human |
| Conjugation | FITC |
USD 540.00
2 Weeks
Integrin alpha E (ITGAE) mouse monoclonal antibody, clone B-ly7, PerCP-Cy5.5
| Applications | FC |
| Reactivities | Human |
| Conjugation | PerCP-Cy5.5 |
Integrin alpha E (ITGAE) mouse monoclonal antibody, clone B-ly7, PE
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
HLA-DRA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HLA-DRA |
Mouse monoclonal Anti-Neutrophil elastase Clone NP57
| Reactivities | Human |
| Conjugation | Unconjugated |
CD16 (FCGR3A) mouse monoclonal antibody, clone GRM1, Purified
| Applications | FC, IHC, IP, WB |
| Reactivities | Human |
CD40 (C-term) rabbit polyclonal antibody, Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | CD40 antibody was raised against a synthetic peptide derived from C-terminal of human CD40 |
Rabbit polyclonal NMDAR2B (Tyr1336) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human NMDAR2B around the phosphorylation site of tyrosine 1336 (S-P-YP-A-H). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-HLA-DOB antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human HLA-DOB. |
Mouse Anti-Human CD40 Purified (100 ug)
| Reactivities | Human |
| Conjugation | Unconjugated |
HLA-DRB3 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HLA-DRB3 |
Rabbit Polyclonal Anti-CD40LG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD40LG antibody: synthetic peptide directed towards the middle region of human CD40LG. Synthetic peptide located within the following region: ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN |
Rabbit Polyclonal Anti-CD40 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: SQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCD |
Rabbit Polyclonal Anti-CD40 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: WNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV |
Goat Polyclonal Anti-TNF alpha Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant human TNF-_ produced in E. coli. |
Mouse Monoclonal Anti-TNF Antibody, Biotinylated
| Applications | E |
| Reactivities | Human, Monkey |
| Conjugation | Biotin |
TNF alpha (TNF) mouse monoclonal antibody, clone Mab1, Purified
| Applications | ELISA, FN, WB |
| Reactivities | Human |
CD28 mouse monoclonal antibody, clone B-T3, Azide Free
| Applications | FC, FN, IHC |
| Reactivities | Human |
NMDAR2B (GRIN2B) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Peptide mapping at the N-terminus of NMDAR2B of human origin |
Rabbit polyclonal anti-FCGR2A antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human FCGR2A. |
Rabbit polyclonal GRIN2B(Ab-1303) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human GRIN2B around the phosphorylation site of serine 1303 (Q-H-SP-Y-D). |
Rabbit polyclonal anti-HLA-DOA antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human HLA-DOA. |
Active filters
Families
- Transmembrane
Pathways
- Systemic lupus erythematosus
Filter by
Category
Target Symbol
- CD40 (125)
- CD80 (103)
- FCGR2A (63)
- CD86 (62)
- TNF (60)
- FCGR1A (40)
- CD28 (37)
- FCGR3A (28)
- GRIN2B (18)
- CD40LG (13)
- HLA-DQA2 (13)
- GRIN2A (8)
- FCGR2B (7)
- HLA-DRB5 (6)
- ELANE (4)
- HLA-DRA (4)
- HLA-DMB (3)
- HLA-DRB3 (3)
- C8B (2)
- FCGR2C (2)
- HLA-DMA (2)
- HLA-DOA (2)
- HLA-DOB (2)
- HLA-DPA1 (2)
- HLA-DPB1 (2)
- HLA-DQA1 (1)
- HLA-DQB1 (1)
- HLA-DRB1 (1)
- HLA-DRB4 (1)