Rabbit Polyclonal Shc (Tyr427) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Shc around the phosphorylation site of Tyrosine 427 |
| Modifications | Phospho-specific |
Rabbit polyclonal PRKCG (Ab-655) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PRKCG around the phosphorylation site of threonine 655 (A-L-TP-P-P). |
Rabbit Polyclonal Phospho-PKCB (Ser661) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PKCB around the phosphorylation site of Serine 661 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-PKC alpha (Thr638) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PKC alpha around the phosphorylation site of Threonine 638 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-PKC-pan (Thr497) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PKC-pan around the phosphorylation site of Threonine 497 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-PLCG1 (Tyr771) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PLCG1 around the phosphorylation site of Tyrosine 771 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-PLCG1 (Tyr783) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PLCG1 around the phosphorylation site of Tyrosine 783 |
| Modifications | Phospho-specific |
Rabbit Polyclonal PKCB Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PKCB |
Rabbit Polyclonal PLCG2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PLCG2 |
Rabbit Polyclonal PKC alpha Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PKC alpha |
Rabbit Polyclonal PKC-pan Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PKC-pan |
Rabbit Polyclonal PLCG1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PLCG1 |
Rabbit Polyclonal PLCG1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PLCG1 |
Rabbit Polyclonal Phospho-PLCG2 (Tyr753) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human PLCG2 around the phosphorylation site of Tyrosine 753. |
| Modifications | Phospho-specific |
Rabbit polyclonal Anti-PRKCG Antibody
| Applications | Assay, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRKCG antibody: synthetic peptide directed towards the N terminal of human PRKCG. Synthetic peptide located within the following region: FVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL |
Rabbit Polyclonal Anti-Atp6v0a1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Atp6v0a1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TLNFGGIRVGNGPTEEDAEIIQHDQLSTHSEDAEEPTEDEVFDFGDTMVH |
Rabbit polyclonal antibody to Sec61 gamma subunit (Sec61 gamma subunit)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 2 and 66 of Sec61 gamma |
Rabbit polyclonal PKC a (Tyr657) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PKC a around the phosphorylation site of tyrosine 657 (F-S-YP-V-N). |
| Modifications | Phospho-specific |
Rabbit polyclonal PLCG1 (Tyr771) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PLCG1 around the phosphorylation site of tyrosine 771 (P-D-YP-G-A) |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-ATP6V1H antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ATP6V1H. |
Rabbit polyclonal anti-PKC beta antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to the C-terminus of mouse PKC β1 |
Anti-PLCG1 (phospho-Tyr771) Rabbit Polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of tyrosine 771 (P-D-Y(p)-G-A) derived from Human PLC-?1. |
| Modifications | Phospho-specific |
Rabbit Polyclonal anti-GNAS antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GNAS antibody: synthetic peptide directed towards the N terminal of human GNAS. Synthetic peptide located within the following region: SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV |
Rabbit Polyclonal Anti-ATP6V1B2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP6V1B2 antibody: synthetic peptide directed towards the middle region of human ATP6V1B2. Synthetic peptide located within the following region: NFIAQGPYENRTVFETLDIGWQLLRIFPKEMLKRIPQSTLSEFYPRDSAK |
Rabbit Polyclonal Anti-PRKACB Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRKACB antibody: synthetic peptide directed towards the middle region of human PRKACB. Synthetic peptide located within the following region: NGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDI |
Rabbit anti ZO-1 Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Goat Polyclonal Antibody against SEC61A1
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KEQSEVGSMGALLF, from the C Terminus of the protein sequence according to NP_037468.1. |
Goat Polyclonal Antibody against ARF1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EGLDWLSNQLRNQK, from the C Terminus of the protein sequence according to NP_001019397.1; NP_001649.1; NP_001019398.1; NP_001019399.1. |
Goat Anti-KCNQ1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EQLTVPRRGPDEGS, from the C-Terminus of the protein sequence according to NP_000209.2; NP_861463.1. |
Rabbit Polyclonal antibody to ATP6V0A2 (ATPase, H+ transporting, lysosomal V0 subunit a2)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 156 and 434 of ATP6V0A2 (Uniprot ID#Q9Y487) |
Rabbit anti-ACTG1 polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide conjugated to KLH |
Rabbit Polyclonal TCIRG1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | TCIRG1 antibody was raised against a 19 amino acid synthetic peptide near the amino terminus of human TCIRG1. |
Anti-ATP6AP1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 90-390 amino acids of human ATPase, H+ transporting, lysosomal accessory protein 1 |
Anti-PLCG1 (Phospho-Tyr783) Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of tyrosine 783 (G-F-Y(p)-V-E) derived from Human PLCG1. |
| Modifications | Phospho-specific |
Anti-PLCG1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa. 781~785 (G-F-Y-V-E) derived from Human PLC?1. |
Anti-PLCG2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to N terminal 300 amino acids of human phospholipase C, gamma 2 (phosphatidylinositol-specific) |
Rabbit Polyclonal Anti-ATP6V0D1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ATP6V0D1 antibody is: synthetic peptide directed towards the C-terminal region of Human ATP6V0D1. Synthetic peptide located within the following region: KLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQ |
Phospho-PLCG2-Y1217 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding Y1217 of human PLCG2 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ATP6V1B1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP6V1B1 antibody: synthetic peptide directed towards the middle region of human ATP6V1B1. Synthetic peptide located within the following region: LMKSAIGEGMTRKDHGDVSNQLYACYAIGKDVQAMKAVVGEEALTSEDLL |
Rabbit Polyclonal Anti-ATP6V1B2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP6V1B2 antibody: synthetic peptide directed towards the N terminal of human ATP6V1B2. Synthetic peptide located within the following region: VSRNYLSQPRLTYKTVSGVNGPLVILDHVKFPRYAEIVHLTLPDGTKRSG |
Rabbit Polyclonal Anti-PRKACB Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRKACB antibody: synthetic peptide directed towards the N terminal of human PRKACB. Synthetic peptide located within the following region: MGNAATAKKGSEVESVKEFLAKAKEDFLKKWENPTQNNAGLEDFERKKTL |
Rabbit Polyclonal Anti-KCNQ1 Antibody
| Applications | WB |
| Reactivities | Hamster, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNQ1 antibody: synthetic peptide directed towards the N terminal of human KCNQ1. Synthetic peptide located within the following region: IVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGS |
Rabbit Polyclonal Anti-ATP6V1G3 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Atp6v1g3 antibody is: synthetic peptide directed towards the middle region of Mouse Atp6v1g3. Synthetic peptide located within the following region: MTSQSQGIQQLLQAEKRAKDKLDEAKKRKGKRLRQAKEEAVAETDQYRMQ |
Germany
Japan
United Kingdom
China
