Germany
Japan
United Kingdom
China
Biotinylated Anti-Human IL-17E Rabbit Polyclonal Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human IL-17E |
Antibodies
Download
Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit anti-IL7R Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IL7R |
USD 380.00
In Stock
Rabbit Polyclonal VEGFR2 (Tyr1214) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human VEGFR2 around the phosphorylation site of Tyrosine 1214 |
| Modifications | Phospho-specific |
Goat Polyclonal Anti-VEGFR2 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from the N-terminus (residues 20-125 aa) of human VEGFR2 produced in E. coli. |
Rabbit Polyclonal Anti-AMH Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AMH Antibody: synthetic peptide directed towards the middle region of human AMH. Synthetic peptide located within the following region: SVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARG |
Rabbit anti-LTBR Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human LTBR |
Rabbit Polyclonal Anti-IL-12A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | IL-12A antibody was raised against an 18 amino acid peptide near the carboxy terminus of human IL-12A. The immunogen is located within the last 50 amino acids of IL-12A. |
Rabbit Polyclonal CX3CR1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | CX3CR1 antibody was raised against a 20 amino acid peptide near the amino terminus of human CX3CR1. The immunogen is located within the first 50 amino acids of CX3CR1. |
Rabbit polyclonal TGFBR2 (Ab-250) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TGFBR2 around the phosphorylation site of serine 250 (D-R-SP-D-I). |
Rabbit polyclonal IL1R Antibody (C-term E487)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL1R antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 474-503 amino acids from the C-terminal region of human IL1R. |
Rabbit Polyclonal Anti-Interleukin 12A Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Interleukin 12A Antibody: A synthesized peptide derived from human Interleukin 12A |
Rabbit Polyclonal CXCR4 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | CXCR4 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human CXCR4. The immunogen is located within the first 50 amino acids of CXCR4. |
Rabbit Polyclonal antibody to Activin A Receptor type IIA (activin A receptor, type IIA)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 267 and 513 of Activin A Receptor type IIA (Uniprot ID#P27037) |
Anti-Human BCA-1 Rabbit Polyclonal Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human BCA-1 (CXCL13) |
Rabbit Polyclonal Anti-PDGFB Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDGFB antibody: synthetic peptide directed towards the N terminal of human PDGFB. Synthetic peptide located within the following region: NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD |
Rabbit Polyclonal Anti-TGFR2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TGFR2 Antibody: A synthesized peptide derived from human TGFR2 |
Goat Anti-IL18 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NPPDNIKDTKSDI, from the internal region of the protein sequence according to NP_001553.1. |
CCR6 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Human, Gorilla |
| Conjugation | Unconjugated |
| Immunogen | CCR6 antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human CCR6. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon (94%); Monkey (89%); Opossum (83%). |
Active filters
Isotypes
- IgG
Pathways
- Cytokine-cytokine receptor interaction
Filter by
Target Symbol
- EGFR (51)
- AMH (38)
- KDR (21)
- CSF1R (16)
- MET (15)
- KIT (14)
- PDGFRB (14)
- TNFRSF11B (12)
- CXCL12 (11)
- IL2 (11)
- IL4 (11)
- PDGFB (11)
- TNFSF11 (11)
- VEGFA (11)
- EPOR (10)
- TNF (10)
- CCR5 (9)
- CD70 (9)
- LEP (9)
- NGFR (9)
- TGFBR2 (9)
- TNFRSF1B (9)
- VEGFB (9)
- CCL2 (8)
- CD40 (8)
- CXCR4 (8)
- EDA (8)
- EGF (8)
- FASLG (8)
- FLT1 (8)
- IL17A (8)
- KITLG (8)
- TGFB1 (8)
- TGFBR1 (8)
- TNFSF10 (8)
- TNFSF13 (8)
- CX3CR1 (7)
- FAS (7)
- IFNG (7)
- IL12A (7)
- IL7 (7)
- PDGFRA (7)
- TGFB2 (7)
- TNFRSF10B (7)
- BMPR2 (6)
- CCL27 (6)
- CCR7 (6)
- CCR8 (6)
- CSF1 (6)
- CXCL1 (6)
- FLT3 (6)
- IFNB1 (6)
- IL10RA (6)
- IL11RA (6)
- IL18R1 (6)
- IL22RA1 (6)
- IL23A (6)
- IL9 (6)
- PDGFA (6)
- TNFRSF1A (6)
- TNFSF12 (6)
- TNFSF13B (6)
- ACVR1 (5)
- ACVR1B (5)
- BMP7 (5)
- CCL11 (5)
- CCR3 (5)
- CNTF (5)
- CSF2 (5)
- CSF2RA (5)
- CSF3 (5)
- CX3CL1 (5)
- CXCL14 (5)
- CXCR2 (5)
- CXCR3 (5)
- HGF (5)
- IL10 (5)
- IL15 (5)
- IL1B (5)
- IL20 (5)
- IL21 (5)
- IL2RA (5)
- IL2RB (5)
- IL3 (5)
- IL6 (5)
- INHBA (5)
- PDGFC (5)
- TNFRSF10A (5)
- TNFRSF21 (5)
- TNFRSF25 (5)
- TNFRSF8 (5)
- TNFSF15 (5)
- CCL16 (4)
- CCL28 (4)
- CCL3 (4)
- CCL5 (4)
- CCR6 (4)
- CD40LG (4)
- CTF1 (4)
- CXCL10 (4)
Reactivities
Applications
Antibody Hosts
Clonalities
Conjugates
Modifications
Families
- Druggable Genome (1126)
- Transmembrane (720)
- Secreted Protein (643)
- ES Cell Differentiation/IPS (256)
- Protein Kinase (201)
- Adult stem cells (96)
- GPCR (72)
- Cancer stem cells (60)
- Stem cell relevant signaling - JAK/STAT signaling pathway (54)
- Embryonic stem cells (36)
- Transcription Factors (26)
- Induced pluripotent stem cells (21)
- Stem cell - Pluripotency (19)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (9)
- Protease (5)
- Stem cell relevant signaling - DSL/Notch pathway (3)