Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-DAF Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DAF antibody was raised against an 18 amino acid peptide near the carboxy terminus of human DAF. The immunogen is located within amino acids 360 - 410 of DAF. |
Rabbit anti-IL7R Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IL7R |
Goat Polyclonal Anti-CD19 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide within residues 510 aa to the C-terminus of human CD19 produced in E. coli. |
Rabbit polyclonal IL1R Antibody (C-term E487)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL1R antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 474-503 amino acids from the C-terminal region of human IL1R. |
Goat Polyclonal Anti-CD4 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within 50 to 235 aa, corresponding to the external domain of human CD4 produced in E. coli. |
Rabbit Polyclonal CD44 (Ser706) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CD44 around the phosphorylation site of Serine 706 |
| Modifications | Phospho-specific |
Rabbit anti-GP9 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GP9 |
Goat Anti-CD20 / MS4A1 (C Terminus) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CQDQESSPIENDSSP, from the C Terminus of the protein sequence according to NP_068769.2; NP_690605.1. |
Rabbit polyclonal antibody to CD41/Integrin alpha 2b (integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 210 and 532 of Integrin alpha 2b (Uniprot ID#P08514) |
CD59 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CD59 |
Rabbit anti-CD1D Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CD1D |
TMEM16A (ANO1) mouse monoclonal antibody, clone DOG1.1, Supernatant
| Applications | IHC |
| Reactivities | Human |
USD 515.00
In Stock
Anti-HLA-DRA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 26-216 amino acids of human major histocompatibility complex, class II, DR alpha |
Rabbit polyclonal CSFR (Ab-809) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CSFR around the phosphorylation site of tyrosine 809 (S-N-YP-I-V). |
Rabbit anti-EPO Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human EPO |
Rabbit anti-TFRC Polyclonal Antibody
| Applications | ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TFRC |
Rabbit polyclonal IL-9R (Ser519) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IL-9R around the phosphorylation site of serine 519 (A-R-SP-W-T). |
| Modifications | Phospho-specific |
HLA-DRA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HLA-DRA |
Rabbit anti-CD3E Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CD3E |
IL1A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IL1A |
Rabbit anti-ANPEP Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ANPEP |
Rabbit Polyclonal Anti-CD1E Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD1E antibody is: synthetic peptide directed towards the C-terminal region of Human CD1E. Synthetic peptide located within the following region: WVMWMRGEQEQRGTQRGDVLPNADETWWIFHLSHPDLFDCDSYPGHIGCS |
Rabbit polyclonal anti-G-CSF antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 195 of human G-CSF |
Rabbit polyclonal anti-GM-CSF antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human GM-CSF protein. |
Rabbit polyclonal CD38 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD38 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 241-270 amino acids from the C-terminal region of human CD38. |
Rabbit polyclonal Neprilysin Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Neprilysin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 506-534 amino acids from the C-terminal region of human Neprilysin. |
Rabbit anti-IL-6R Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IL-6R |
Rabbit anti-IL1R2 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IL1R2 |
Active filters
Isotypes
- IgG
Pathways
- Hematopoietic cell lineage
Filter by
Category
Target Symbol
- CSF1R (16)
- CD44 (15)
- KIT (14)
- IL4 (11)
- ITGB3 (11)
- EPOR (10)
- TNF (10)
- CD22 (8)
- KITLG (8)
- MME (8)
- IL7 (7)
- THPO (7)
- ANPEP (6)
- CD19 (6)
- CD55 (6)
- CSF1 (6)
- FLT3 (6)
- IL11RA (6)
- ITGA4 (6)
- CD4 (5)
- CSF2 (5)
- CSF2RA (5)
- CSF3 (5)
- GYPA (5)
- IL1B (5)
- IL2RA (5)
- IL3 (5)
- IL6 (5)
- ITGA6 (5)
- CD36 (4)
- CD38 (4)
- CD8A (4)
- CD8B (4)
- CD9 (4)
- EPO (4)
- IL1A (4)
- IL1R2 (4)
- IL3RA (4)
- IL5 (4)
- ITGA5 (4)
- TFRC (4)
- BMP2 (3)
- CD14 (3)
- CD1A (3)
- CD1D (3)
- CD33 (3)
- CD34 (3)
- CD59 (3)
- DNTT (3)
- FCER2 (3)
- GP1BA (3)
- IL11 (3)
- IL1R1 (3)
- IL4R (3)
- ITGA2B (3)
- ITGAM (3)
- MS4A1 (3)
- CD1E (2)
- CD2 (2)
- CD3E (2)
- CD5 (2)
- CR2 (2)
- CSF3R (2)
- FCGR1A (2)
- HLA-DRA (2)
- HLA-DRB3 (2)
- IL6R (2)
- IL7R (2)
- ITGA2 (2)
- ITGA3 (2)
- TPO (2)
- CD1B (1)
- CD3D (1)
- CR1 (1)
- FLT3LG (1)
- GP1BB (1)
- GP9 (1)
- HLA-DRB1 (1)
- HLA-DRB4 (1)
- IL5RA (1)
- IL9R (1)
Reactivities
Applications
Antibody Hosts
Clonalities
Conjugates
Modifications
Families
- Druggable Genome (328)
- Transmembrane (274)
- ES Cell Differentiation/IPS (142)
- Secreted Protein (121)
- Adult stem cells (51)
- Embryonic stem cells (42)
- Protein Kinase (36)
- Cancer stem cells (25)
- Protease (18)
- Stem cell relevant signaling - DSL/Notch pathway (15)
- Stem cell - Pluripotency (14)
- Induced pluripotent stem cells (12)
- Transcription Factors (10)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (3)