Mouse Monoclonal Antibody against Thimet Oligopeptidase (4D6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Antibody against Thimet Oligopeptidase (4D6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal antibody to Angiotensinogen (angiotensinogen (serpin peptidase inhibitor, clade A, member 8))
Reactivities | Human |
Rabbit Polyclonal antibody to Renin (renin)
Applications | IHC, WB |
Reactivities | Human |
Immunogen | Recombinant fragment corresponding to a region within amino acids 70 and 332 of Renin (Uniprot ID#P00797) |
Rabbit polyclonal CATG (Cleaved-Ile21) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human CATG. |
Rabbit Polyclonal LNPEP Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | LNPEP antibody was raised against a 15 amino acid synthetic peptide near the carboxy terminus of human LNPEP. |
Rabbit polyclonal MME Antibody (Center)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This MME antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 721-747 amino acids from the C-terminal region of human MME. |
Rabbit Polyclonal Anti-MAS1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MAS1 antibody: synthetic peptide directed towards the middle region of human MAS1. Synthetic peptide located within the following region: RPKYQSALVCALLWALSCLVTTMEYVMCIDREEESHSRNDCRAVIIFIAI |
Rabbit Polyclonal Anti-ANPEP Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ANPEP antibody: synthetic peptide directed towards the N terminal of human ANPEP. Synthetic peptide located within the following region: VGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLA |
CD10 (MME) mouse monoclonal antibody, clone B-E3, PE
Applications | FC |
Reactivities | Human |
Conjugation | PE |
CD13 (ANPEP) mouse monoclonal antibody, clone B-F10, Azide Free
Applications | FC |
Reactivities | Human |
CD13 (ANPEP) mouse monoclonal antibody, clone B-F10, FITC
Applications | FC |
Reactivities | Human |
Conjugation | FITC |
CD13 (ANPEP) mouse monoclonal antibody, clone B-F10, Purified
Applications | FC |
Reactivities | Human |
Angiotensinogen (AGT) mouse monoclonal antibody, clone B937M, Purified
Applications | ELISA |
Reactivities | Human |
Angiotensinogen (AGT) mouse monoclonal antibody, clone B938M, Purified
Applications | ELISA |
Reactivities | Human |
Angiotensin Converting Enzyme 2 (ACE2) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
CMA1 (96-110) goat polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Monkey |
Immunogen | Synthetic peptide from an internal region of human CMA1 / Mast Cell Chymase (NP_001827.1) |
CD13 (ANPEP) mouse monoclonal antibody, clone WM15, APC
Applications | FC |
Reactivities | Human, Primate |
Conjugation | APC |
CD13 (ANPEP) mouse monoclonal antibody, clone WM15, FITC
Applications | FC |
Reactivities | Human, Primate |
Conjugation | FITC |
CD13 (ANPEP) mouse monoclonal antibody, clone WM15, PE
Applications | FC |
Reactivities | Human, Primate |
Conjugation | PE |
Goat Anti-CMA1 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QFRHPKYNTSTLHHD, from the internal region of the protein sequence according to NP_001827.1. |
AGTR2 / AT2 Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Bat, Bovine, Hamster, Human, Monkey, Mouse, Rat, Sheep, Gorilla, Dog, Pig, Horse, Gibbon |
Conjugation | Unconjugated |
Immunogen | AGTR2 / AT2 Receptor antibody was raised against synthetic 16 amino acid peptide from internal region of human AGTR2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Sheep, Dog, Bat, Bovine, Hamster, Elephant, Panda, Horse, Pig (100%). |
Mouse Anti-Human CD13 Purified (100 ug)
Applications | FC |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Anti-Human CD10 Purified (100 ug)
Applications | FC |
Reactivities | Human |
Conjugation | Unconjugated |
REN Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human REN |
Goat Anti-CD13 / ANPEP (aa79-91) Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-TLKPDSYRVTLRP, from the internal region (near N terminus) of the protein sequence according to NP_001141.2 |
Goat Anti-CD13 / ANPEP Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QLEQFKKDNEET, from the internal region (near C terminus) of the protein sequence according to NP_001141.2 |
Rabbit Polyclonal Anti-MAS1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MAS1 antibody is: synthetic peptide directed towards the N-terminal region of Human MAS1. Synthetic peptide located within the following region: VTSFVVEEPTNISTGRNASVGNAHRQIPIVHWVIMSISPVGFVENGILLW |
Rabbit Polyclonal Anti-AGT Antibody (Internal)
Applications | IHC |
Reactivities | Human |
Immunogen | AGT / Angiotensinogen antibody was raised against synthetic 13 amino acid peptide from internal region of human AGT / Angiotensinogen. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey (100%); Marmoset (85%). |
Rabbit Polyclonal Anti-AGT Antibody (Internal)
Applications | IHC |
Reactivities | Human |
Immunogen | AGT / Angiotensinogen antibody was raised against synthetic 12 amino acid peptide from internal region of human AGT / Angiotensinogen. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset (100%). |
Rabbit Polyclonal Anti-AGTR2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AGTR2 antibody: synthetic peptide directed towards the N terminal of human AGTR2. Synthetic peptide located within the following region: LHFGLVNISGNNESTLNCSQKPSDKHLDAIPILYYIIFVIGFLVNIVVVT |
Rabbit Polyclonal Anti-NLN Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NLN antibody is: synthetic peptide directed towards the N-terminal region of NLN. Synthetic peptide located within the following region: CLQALADVEVKYIVERTMLDFPQHVSSDKEVRAASTEADKRLSRFDIEMS |
Mouse monoclonal Anti-CALLA Clone SS2/36
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti CD10 Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to internal region of human CD10 |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) THOP1 mouse monoclonal antibody, clone OTI2D3 (formerly 2D3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ENPEP mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ENPEP mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ENPEP mouse monoclonal antibody, clone OTI3E7 (formerly 3E7)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ENPEP mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NLN mouse monoclonal antibody, clone OTI3A12 (formerly 3A12)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NLN mouse monoclonal antibody, clone OTI3C2 (formerly 3C2)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ENPEP mouse monoclonal antibody, clone OTI1D4 (formerly 1D4)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ENPEP mouse monoclonal antibody, clone OTI3G1 (formerly 3G1)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ENPEP mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NLN mouse monoclonal antibody, clone OTI2F2 (formerly 2F2)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NLN mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NLN mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NLN mouse monoclonal antibody, clone OTI2H1 (formerly 2H1)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ENPEP mouse monoclonal antibody, clone OTI4G8 (formerly 4G8)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NLN mouse monoclonal antibody, clone OTI3H4 (formerly 3H4)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NLN mouse monoclonal antibody, clone OTI3G8 (formerly 3G8)
Applications | WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |