Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal antibody to Angiotensinogen (angiotensinogen (serpin peptidase inhibitor, clade A, member 8))
| Reactivities | Human |
Rabbit polyclonal CATG (Cleaved-Ile21) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human CATG. |
Rabbit polyclonal MME Antibody (Center)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This MME antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 721-747 amino acids from the C-terminal region of human MME. |
Rabbit Polyclonal Anti-MAS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAS1 antibody: synthetic peptide directed towards the middle region of human MAS1. Synthetic peptide located within the following region: RPKYQSALVCALLWALSCLVTTMEYVMCIDREEESHSRNDCRAVIIFIAI |
Rabbit Polyclonal Anti-ANPEP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANPEP antibody: synthetic peptide directed towards the N terminal of human ANPEP. Synthetic peptide located within the following region: VGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLA |
CD10 (MME) mouse monoclonal antibody, clone B-E3, PE
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
CD13 (ANPEP) mouse monoclonal antibody, clone B-F10, Azide Free
| Applications | FC |
| Reactivities | Human |
CD13 (ANPEP) mouse monoclonal antibody, clone B-F10, FITC
| Applications | FC |
| Reactivities | Human |
| Conjugation | FITC |
CD13 (ANPEP) mouse monoclonal antibody, clone B-F10, Purified
| Applications | FC |
| Reactivities | Human |
Angiotensinogen (AGT) mouse monoclonal antibody, clone B937M, Purified
| Applications | ELISA |
| Reactivities | Human |
Angiotensinogen (AGT) mouse monoclonal antibody, clone B938M, Purified
| Applications | ELISA |
| Reactivities | Human |
Angiotensin Converting Enzyme 2 (ACE2) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
CD13 (ANPEP) mouse monoclonal antibody, clone WM15, APC
| Applications | FC |
| Reactivities | Human, Primate |
| Conjugation | APC |
CD13 (ANPEP) mouse monoclonal antibody, clone WM15, FITC
| Applications | FC |
| Reactivities | Human, Primate |
| Conjugation | FITC |
CD13 (ANPEP) mouse monoclonal antibody, clone WM15, PE
| Applications | FC |
| Reactivities | Human, Primate |
| Conjugation | PE |
Goat Anti-CMA1 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QFRHPKYNTSTLHHD, from the internal region of the protein sequence according to NP_001827.1. |
AGTR2 / AT2 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Hamster, Human, Monkey, Mouse, Rat, Sheep, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | AGTR2 / AT2 Receptor antibody was raised against synthetic 16 amino acid peptide from internal region of human AGTR2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Sheep, Dog, Bat, Bovine, Hamster, Elephant, Panda, Horse, Pig (100%). |
Mouse Anti-Human CD13 Purified (100 ug)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Anti-Human CD10 Purified (100 ug)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
REN Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human REN |
Goat Anti-CD13 / ANPEP (aa79-91) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TLKPDSYRVTLRP, from the internal region (near N terminus) of the protein sequence according to NP_001141.2 |
Goat Anti-CD13 / ANPEP Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QLEQFKKDNEET, from the internal region (near C terminus) of the protein sequence according to NP_001141.2 |
Rabbit Polyclonal Anti-MAS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MAS1 antibody is: synthetic peptide directed towards the N-terminal region of Human MAS1. Synthetic peptide located within the following region: VTSFVVEEPTNISTGRNASVGNAHRQIPIVHWVIMSISPVGFVENGILLW |
Rabbit Polyclonal Anti-AGT Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | AGT / Angiotensinogen antibody was raised against synthetic 13 amino acid peptide from internal region of human AGT / Angiotensinogen. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey (100%); Marmoset (85%). |
Rabbit Polyclonal Anti-AGT Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | AGT / Angiotensinogen antibody was raised against synthetic 12 amino acid peptide from internal region of human AGT / Angiotensinogen. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset (100%). |
Rabbit Polyclonal Anti-AGTR2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AGTR2 antibody: synthetic peptide directed towards the N terminal of human AGTR2. Synthetic peptide located within the following region: LHFGLVNISGNNESTLNCSQKPSDKHLDAIPILYYIIFVIGFLVNIVVVT |
Rabbit Polyclonal Anti-NLN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NLN antibody is: synthetic peptide directed towards the N-terminal region of NLN. Synthetic peptide located within the following region: CLQALADVEVKYIVERTMLDFPQHVSSDKEVRAASTEADKRLSRFDIEMS |
Mouse monoclonal Anti-CALLA Clone SS2/36
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti CD10 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to internal region of human CD10 |
USD 465.00
4 Weeks
Active filters
Pathways
- Renin-angiotensin system