Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-TGF beta2 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human TGF β2. |
Antibodies
View as table Download
Rabbit polyclonal anti-TGF beta3 antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human TGF β3. |
Rabbit polyclonal anti-ACVR1C (ALK7) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 155 of mouse ALK-7 |
Rabbit polyclonal SMAD3 phospho S423/phospho S425 antibody
| Applications | IHC, WB |
| Reactivities | Human, Zebrafish, Rat, Mouse, Swine, Bovine, Chicken |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 417-425 of human SMAD3 protein. |
Anti-RHOA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 177-189 amino acids of Human ras homolog family member A |
Rabbit Polyclonal ERK1/2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ERK1/2 |
Rabbit Polyclonal ERK1/2 (Thr202/Tyr204) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ERK1/2 around the phosphorylation site of Threonine 202/Tyrosine 204 |
| Modifications | Phospho-specific |
Rabbit Polyclonal SP1 (Thr453) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human SP1 around the phosphorylation site of Threonine 453 |
| Modifications | Phospho-specific |
Rabbit Polyclonal SP1 (Thr739) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human SP1 around the phosphorylation site of Threonine 739 |
| Modifications | Phospho-specific |
Rabbit anti-ACVR1B Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ACVR1B |
Rabbit anti-BMPR2 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human BMPR2 |
Rabbit Polyclonal Anti-BMP6 Antibody - middle region
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BMP6 antibody: synthetic peptide directed towards the middle region of human BMP6. Synthetic peptide located within the following region: MVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSEL |
Rabbit Polyclonal Anti-E2F4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-E2F4 Antibody: A synthesized peptide derived from human E2F4 |
Rabbit Polyclonal Anti-p15 INK Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-p15 INK Antibody: A synthesized peptide derived from human p15 INK |
Rabbit Polyclonal Anti-MYC Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYC Antibody: A synthesized peptide derived from human MYC |
Rabbit Polyclonal Anti-Smad4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Smad4 Antibody: A synthesized peptide derived from human Smad4 |
Rabbit Polyclonal Anti-Smad1/5/9 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Smad1/5/9 Antibody: A synthesized peptide derived from human Smad1/5/9 |
Rabbit Polyclonal Anti-MAPK1/3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAPK1/3 Antibody: A synthesized peptide derived from human MAPK1/3 |
Rabbit Polyclonal Anti-CBP Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CBP Antibody: A synthesized peptide derived from human CBP |
Rabbit Polyclonal Anti-TGF beta1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TGF beta1 Antibody: The antiserum was produced against synthesized peptide derived from human TGF beta. |
Rabbit Polyclonal Anti-Smad7 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Smad7 Antibody: A synthesized peptide |
Rabbit Polyclonal Anti-Phospho-p70 S6 Kinase (Ser371) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Phospho-p70 S6 Kinase (Ser371) Antibody: A synthesized peptide derived from human p70 S6 Kinase around the phosphorylation site of Serine 371 |
| Modifications | Phospho-specific |
Goat Polyclonal Anti-TNF alpha Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant human TNF-_ produced in E. coli. |
Rabbit Polyclonal GDF6 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | GDF6 antibody was raised against a 17 amino acid peptide near the carboxy terminus of the human GDF6. |
Rabbit polyclonal Smad2 (Ab-220) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Smad2 around the phosphorylation site of threonine 220 (P-E-TP-P-P). |
Rabbit polyclonal Smad2 (Thr220) antibody(Phospho-specific)
| Applications | IF |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Smad2 around the phosphorylation site of threonine 220 (P-E-TP-P-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal Smad3 (Ab-204) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Smad3 around the phosphorylation site of serine 204 (A-G-SP-P-N). |
Rabbit polyclonal Smad3 (Ser204) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Smad3 around the phosphorylation site of serine 204 (A-G-SP-P-N). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-Smad1/5/9 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human Smad1/5/9. |
Rabbit polyclonal anti-ID4 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ID4. |
Rabbit polyclonal anti-FST antibody
| Applications | WB |
| Reactivities | Human Mouse Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FST. |
Rabbit polyclonal anti-Decorin antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rabbit, Rat, Pig |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 130 of human Decorin |
Anti-RPS6KB1 (Phospho-Ser411) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of serine 411 (I-R-S(p)-P-R) derived from Human p70 S6 Kinase. |
| Modifications | Phospho-specific |
Anti-RPS6KB1 (Phospho-Ser424) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of serine 424 (P-V-S(p)-P-V) derived from Human p70 S6 Kinase. |
| Modifications | Phospho-specific |
Rabbit polyclonal PITX2 Antibody (C-term)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PITX2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 122-151 amino acids from the C-terminal region of human PITX2. |
Rabbit polyclonal Smad7 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Smad7 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 195-224 amino acids from the Central region of human Smad7. |
Rabbit polyclonal MAPK1 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This MAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 154-183 amino acids from the Central region of human MAPK1. |
Rabbit polyclonal MAPK3 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This MAPK3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human MAPK3. |
Rabbit polyclonal MAPK1 Antibody (C-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This MAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 254-285 amino acids from the C-terminal region of human MAPK1. |
Rabbit Polyclonal ERK1/2 (Tyr204) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ERK1/2 around the phosphorylation site of Tyrosine 204 |
| Modifications | Phospho-specific |
Rabbit Polyclonal p44/42 MAP Kinase (Thr202) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human p44/42 MAP Kinase around the phosphorylation site of Threonine 202 |
| Modifications | Phospho-specific |
Active filters
Reactivities
- Rat
Pathways
- TGF-beta signaling pathway
Filter by
Category
Target Symbol
- MAPK1 (69)
- SMAD1 (47)
- ID3 (45)
- CDKN2B (34)
- RPS6KB1 (34)
- MYC (32)
- SMAD2 (26)
- BMP6 (23)
- BMP4 (20)
- ACVR2A (18)
- SMAD3 (18)
- NOG (17)
- E2F5 (16)
- PPP2R1B (16)
- SMURF2 (16)
- TGFB1 (16)
- MAPK3 (15)
- TGFBR2 (14)
- ID2 (13)
- ID4 (13)
- E2F4 (12)
- ROCK2 (11)
- RBL1 (10)
- SMAD7 (8)
- SP1 (8)
- PITX2 (7)
- RHOA (7)
- TGFB2 (7)
- TGFBR1 (7)
- ACVRL1 (6)
- SMAD4 (6)
- BMPR2 (5)
- INHBA (5)
- ROCK1 (5)
- TNF (5)
- ACVR1B (4)
- ACVR1C (4)
- DCN (4)
- EP300 (4)
- SMAD5 (4)
- ACVR1 (3)
- BMP2 (3)
- PPP2CA (3)
- THBS1 (3)
- AMH (2)
- COMP (2)
- CREBBP (2)
- FST (2)
- PPP2CB (2)
- PPP2R1A (2)
- RPS6KB2 (2)
- SKP1 (2)
- TGFB3 (2)
- ACVR2B (1)
- AMHR2 (1)
- BMP5 (1)
- BMP7 (1)
- BMPR1A (1)
- BMPR1B (1)
- CUL1 (1)
- GDF6 (1)
- INHBB (1)
- INHBC (1)
- LEFTY2 (1)
- NODAL (1)
- RBL2 (1)
- SMAD6 (1)
- SMAD9 (1)
- SMURF1 (1)
- TTK (1)
Applications
Antibody Hosts
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Families
- Druggable Genome (644)
- Transcription Factors (330)
- ES Cell Differentiation/IPS (256)
- Protein Kinase (202)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (189)
- Cancer stem cells (145)
- Stem cell relevant signaling - JAK/STAT signaling pathway (135)
- Embryonic stem cells (125)
- Secreted Protein (115)
- Transmembrane (82)
- Induced pluripotent stem cells (81)
- Adult stem cells (64)
- Stem cell - Pluripotency (40)
- Stem cell relevant signaling - Wnt Signaling pathway (32)
- Phosphatase (23)