Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit polyclonal p53 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human p53. |
Rabbit polyclonal p53 (Phospho-Thr387) antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human p53 around the phosphorylation site of threonine 387 (F-K-TP-E-G). |
| Modifications | Phospho-specific |
Rabbit polyclonal p53 (Phospho-Ser46) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human p53 around the phosphorylation site of Serine 46. |
| Modifications | Phospho-specific |
Rabbit Polyclonal anti-TP53 antibody
| Applications | Assay, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Rabbit Polyclonal anti-TP53 antibody
| Applications | Assay, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Rabbit Polyclonal Anti-LEF1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LEF1 antibody: synthetic peptide directed towards the C terminal of human LEF1. Synthetic peptide located within the following region: VKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQ |
Rabbit Polyclonal Wnt-5a Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to amino acids 190-230 of human Wnt5A was used as the immunogen for this antibody, GenBank no NP_003383.2. |
Rabbit Polyclonal WNT2 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal WNT4 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal WNT5B Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal WNT8A Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal Dishevelled 3 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal APC Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
WNT9A (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminal of human WNT9A |
TCF7 (617-631) goat polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Bat, Canine, Equine, Hamster, Human, Mouse, Porcine, Rat |
| Immunogen | Synthetic peptide from positions 617-631 of human TCF1 (NP_000536.5) |
Rabbit polyclonal anti-SMO antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SMO. |
Rabbit polyclonal Catenin-beta (Ab-552) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internalof human CTNNB1. |
Rabbit polyclonal beta-Catenin (Ser37) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human β-Catenin around the phosphorylation site of serine 37 (I-H-SP-G-A). |
| Modifications | Phospho-specific |
Rabbit polyclonal APC (Ser2054) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human APC around the phosphorylation site of serine 2054 (K-P-SP-R-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-TCF7 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human TCF7. |
WNT7A Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Chimpanzee, Hamster, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon |
| Immunogen | WNT7A antibody was raised against synthetic 10 amino acid peptide from internal region of human WNT7A. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Opossum (100%); Chicken, Platypus, Xenopus (80%). |
WNT7A Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Chimpanzee, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat, Xenopus, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | WNT7A antibody was raised against synthetic 12 amino acid peptide from internal region of human WNT7A. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Lizard, Xenopus (100%); Seabass (92%); Stickleback, Pufferfish, Zebrafish (83%). |
Rabbit polyclonal GSK3 Beta phospho S9 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to the aa 4-12 of human GSK3 beta. |
Anti-FZD2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 188-200 amino acids of human frizzled family receptor 2 |
Anti-WNT9A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 273 amino acids of human wingless-type MMTV integration site family, member 9A |
Anti-FZD1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1-14 amino acids of human frizzled family receptor 1 |
Rabbit polyclonal LEF1 Antibody (N-term)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This LEF1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 10-37 amino acids from the N-terminal region of human LEF1. |
Rabbit polyclonal WNT16 Antibody (C-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This WNT16 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-265 amino acids from the C-terminal region of human WNT16. |
Rabbit polyclonal Phospho-p53(S20) Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This p53 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S20 of human p53. |
| Modifications | Phospho-specific |
Rabbit Polyclonal p53 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human p53 |
Active filters
Category
-
Antibodies
- Primary Antibodies
Pathways
- Basal cell carcinoma
Filter by
Target Symbol
- TP53 (255)
- CTNNB1 (162)
- GLI1 (151)
- WNT3 (47)
- DVL2 (40)
- PTCH1 (36)
- GLI2 (22)
- BMP4 (21)
- APC (20)
- GSK3B (20)
- SHH (16)
- PTCH2 (12)
- LEF1 (11)
- SMO (10)
- WNT1 (10)
- TCF7 (9)
- BMP2 (8)
- FZD2 (8)
- FZD4 (8)
- WNT3A (8)
- WNT5B (8)
- WNT2B (7)
- WNT4 (7)
- FZD8 (6)
- FZD9 (6)
- SUFU (6)
- WNT10A (6)
- WNT10B (6)
- WNT6 (6)
- WNT8B (6)
- WNT9A (6)
- WNT9B (6)
- AXIN1 (5)
- FZD1 (5)
- FZD10 (5)
- WNT16 (5)
- WNT2 (5)
- WNT8A (5)
- AXIN2 (4)
- DVL1 (4)
- FZD3 (4)
- FZD5 (4)
- FZD6 (4)
- TCF7L2 (4)
- WNT5A (4)
- APC2 (3)
- DVL3 (3)
- GLI3 (3)
- TCF7L1 (3)
- WNT11 (3)
- FZD7 (2)
- STK36 (2)
- WNT7A (2)
- HHIP (1)
- WNT7B (1)
Reactivities
- Human (945)
- Mouse (653)
- Rat (561)
- Monkey (188)
- Dog (91)
- Bovine (21)
- Pig (14)
- Rabbit (14)
- Gorilla (12)
- Hamster (12)
- Bat (11)
- Horse (11)
- Chicken (10)
- Gibbon (10)
- Primate (7)
- Cow (6)
- Xenopus (6)
- Canine (3)
- Chimpanzee (3)
- Zebrafish (3)
- Guinea Pig (2)
- Macaque (1)
- Opossum (1)
- Orang-Utan (1)
- Quail (1)
- Rhesus Monkey (1)
- Sheep (1)
- Yeast (1)
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Families
- Druggable Genome (966)
- Transcription Factors (601)
- ES Cell Differentiation/IPS (541)
- Stem cell - Pluripotency (255)
- Adult stem cells (250)
- Cancer stem cells (250)
- Transmembrane (233)
- Embryonic stem cells (205)
- Secreted Protein (194)
- Stem cell relevant signaling - DSL/Notch pathway (161)
- Stem cell relevant signaling - Wnt Signaling pathway (50)
- Induced pluripotent stem cells (46)
- GPCR (44)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (29)
- Protein Kinase (22)