Germany
Japan
United Kingdom
China
USD 399.00
In Stock
Antibodies
Download
Rabbit Polyclonal Anti-CD81 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE |
TAPA1 (CD81) mouse monoclonal antibody, clone M38, PE
| Applications | FC |
| Reactivities | Feline, Human, Rabbit |
| Conjugation | PE |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Anti-BCL10 mouse mAb, clone OTI4A8, PE conjugated
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
TAPA1 (CD81) mouse monoclonal antibody, clone M38, Purified
| Applications | FC, FN, IF, IHC, IP, WB |
| Reactivities | Feline, Human, Rabbit |
Anti-BCL10 mouse mAb, clone OTI6A4, PE conjugated
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
Rabbit Polyclonal Antibody against CD19 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD19 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 143-172 amino acids from the N-terminal region of human CD19. |
Goat Polyclonal Anti-CD19 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide within residues 510 aa to the C-terminus of human CD19 produced in E. coli. |
Mouse Monoclonal anti-Syk Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Rabbit Polyclonal SYK (Tyr348) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human SYK around the phosphorylation site of Tyrosine 348 |
| Modifications | Phospho-specific |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit Polyclonal NF- kappaB p105/p50 (Ser932) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NF- kappaB p105/p50 around the phosphorylation site of Serine 932 |
| Modifications | Phospho-specific |
Anti-RAC2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 50-192 amino acids of human ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) |
CD21 (CR2) mouse monoclonal antibody, clone BB6-11C9.6, Purified
| Applications | FC, IHC, IP |
| Reactivities | Porcine |
Rabbit Polyclonal Antibody against PIK3CA (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KCA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 504-533 amino acids from the Central region of human PI3KCA. |
Mouse Monoclonal anti-NFATc1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against RAC1 (S71)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RAC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 49-78 amino acids from human RAC1. |
Rabbit Polyclonal PI3-kinase p85- alpha (Tyr607) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PI3-kinase p85- alpha around the phosphorylation site of Tyrosine 607 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-NFATC2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NFATC2 antibody: synthetic peptide directed towards the C terminal of human NFATC2. Synthetic peptide located within the following region: PTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNLDQTYLDDVNE |
Rabbit Polyclonal Anti-RAC1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAC1 antibody: synthetic peptide directed towards the middle region of human RAC1. Synthetic peptide located within the following region: LAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL |
Active filters
Pathways
- B cell receptor signaling pathway
Filter by
Target Symbol
- MAP2K1 (237)
- JUN (183)
- AKT1 (127)
- CD19 (86)
- BCL10 (74)
- MAPK1 (74)
- BTK (71)
- PIK3AP1 (65)
- CD22 (64)
- FOS (64)
- PIK3CG (64)
- KRAS (58)
- CR2 (57)
- RELA (54)
- MALT1 (50)
- HRAS (47)
- PIK3R5 (47)
- AKT2 (44)
- CD79B (43)
- NFKBIE (42)
- IKBKG (41)
- RASGRP3 (40)
- NFKB1 (36)
- PIK3CD (35)
- MAP2K2 (34)
- RAF1 (33)
- NFKBIA (30)
- CHP1 (28)
- CHUK (26)
- PIK3CA (25)
- DAPP1 (24)
- MAPK3 (23)
- GSK3B (20)
- IKBKB (20)
- AKT3 (19)
- BLNK (19)
- CD79A (18)
- SYK (18)
- NRAS (17)
- PIK3R1 (14)
- PPP3CA (14)
- NFATC1 (13)
- NFKBIB (13)
- PRKCB (12)
- PTPN6 (12)
- GRB2 (11)
- NFATC4 (10)
- VAV1 (10)
- PLCG2 (9)
- PPP3CB (9)
- INPP5D (8)
- CD81 (7)
- FCGR2B (7)
- LYN (7)
- NFATC2 (7)
- CARD11 (6)
- LILRB3 (6)
- NFATC3 (6)
- RAC1 (6)
- IFITM1 (5)
- CD72 (4)
- PIK3CB (4)
- PIK3R3 (4)
- VAV3 (4)
- NFAT5 (3)
- PPP3CC (3)
- SOS2 (3)
- VAV2 (3)
- PIK3R2 (2)
- RAC2 (2)
- SOS1 (2)
- C FOS (1)
- CHP2 (1)
- PPP3R1 (1)
- PPP3R2 (1)
Reactivities
- Human (2101)
- Mouse (1706)
- Rat (1619)
- Dog (365)
- Monkey (325)
- Bovine (25)
- Chicken (17)
- Pig (16)
- Cow (12)
- Rabbit (9)
- Xenopus (9)
- Primate (7)
- Canine (5)
- Drosophila (4)
- Hamster (4)
- Guinea Pig (3)
- Rhesus Monkey (3)
- X. tropicalis (3)
- Canis (2)
- Horse (2)
- Opossum (2)
- Sheep (2)
- C. elegans (1)
- Chimpanzee (1)
- Equine (1)
- Feline (1)
- Goat (1)
- Porcine (1)