Rabbit anti-ALDH2 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ALDH2 |
Rabbit anti-ALDH2 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ALDH2 |
Rabbit anti-ACAT1 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ACAT1 |
Rabbit anti-HADH Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HADH |
Rabbit anti-HADHA Polyclonal Antibody
Applications | ICC/IF, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HADHA |
Rabbit Polyclonal EHMT1 Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EHMT1 antibody: mouse Ehmt1 (euchromatic histone-lysine N-methyltransferase 1), using three KLH-conjugated synthetic peptides containing a sequence from the central part of the protein. |
Rabbit Polyclonal G9a Antibody
Applications | ELISA, WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-G9a antibody: mouse G9a (Protein G9a), using two KLH-conjugated synthetic peptides containing an amino acid sequence from the central part of the protein |
Rabbit Polyclonal Anti-ALDH2 Antibody - C-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Aldh2 antibody is synthetic peptide directed towards the C-terminal region of Mouse Aldh2. Synthetic peptide located within the following region: QPTVFGDVKDGMTIAKEEIFGPVMQILKFKTIEEVVGRANDSKYGLAAAV |
Rabbit Polyclonal Setd1a Antibody
Applications | ELISA, WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Setd1a antibody: mouse Setd1a (Set domain containing 1A), using three KLH-conjugated synthetic peptides: two containing an amino acid sequence from the N-terminal part of the protein and one containing an amino acid sequence from th |
Rabbit Polyclonal Setd1b Antibody
Applications | ELISA, WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Setd1b antibody: mouse Setd1b (Set domain containing 1B), using a 3 KLH-conjugated synthetic peptides containing sequences from the central part of the protein. |
Goat Polyclonal Anti-ACAT1 (aa257-269) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Cow) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ACAT1 (aa257-269) Antibody: Peptide with sequence C-KRVDFSKVPKLKT, from the internal region of the protein sequence according to NP_000010.1. |
Rabbit Polyclonal antibody to BBOX1 (butyrobetaine (gamma), 2-oxoglutarate dioxygenase (gamma-butyrobetaine hydroxylase) 1)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 293 of BBOX1 (Uniprot ID#O75936) |
EHMT2 Rabbit Polyclonal Antibody
Applications | IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human EHMT2 |
Rabbit anti-SUV39H2 Polyclonal Antibody
Applications | ChIP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SUV39H2 |
Rabbit anti-SETDB1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SETDB1 |
Rabbit Polyclonal Antibody against ALDH2 (Center)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This ALDH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 318-347 amino acids from the Central region of human ALDH2. |
Rabbit Polyclonal NSD3 Antibody
Applications | WB |
Reactivities | Bovine, Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to a internal portion of the human protein (within residues 300-400). [Swiss-Prot# Q9BZ95] |
Rabbit anti-WHSC1L1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human WHSC1L1 |
Rabbit Polyclonal SETD8 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SETD8 antibody: human SETD8 (SET domain containing 8), using the full length protein containing a Flag-tagged N-terminus and a His-tagged C terminus. |
Rabbit Polyclonal Antibody against ALDH2 (N-term)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | This ALDH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 52-81 amino acids from the N-terminal region of human ALDH2. |
Rabbit Polyclonal antibody to DLST (dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex))
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 188 and 453 of DLST (Uniprot ID#P36957) |
Rabbit polyclonal anti-AASDHPPT antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AASDHPPT. |
Rabbit polyclonal anti-SUV39H2 antibody
Applications | WB |
Reactivities | Human Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SUV39H2. |
Rabbit Polyclonal Aldh3A2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Aldh3A2 antibody was raised against a 14 amino acid peptide near the carboxy terminus of the human Aldh3A2. |
Goat Anti-ALDH2 Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DETQFKKILGYIN, from the internal region of the protein sequence according to NP_000681.2. |
Rabbit Polyclonal SETD7/9 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Two synthethic peptides corresponding to amino acids 131-145 (GEVNEDGEMTGEKIA) and 336-352 (GYDHSPPGKSGPEAPEW) of human SETD7 were used as immunogen for this antibody. |
Rabbit Polyclonal GLP/EHMT1 Antibody
Applications | IF, IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A genomic peptide made to an N-terminal region of the human EHMT1 protein (within residues 20-200). [Swiss-Prot Q9H9B1] |
Rabbit Polyclonal SUV420h1 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human SUV420h1 protein (between residues 100-150) [UniProt Q4FZB7] |
Rabbit Polyclonal SUV420h1 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human SUV420h1 protein (between residues 450-500) [UniProt Q4FZB7] |
Rabbit Polyclonal Antibody against EHMT1 (C-term)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This EHMT1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1145-1174 amino acids from the C-terminal region of human EHMT1. |
Goat Polyclonal Antibody against HADH / HADHSC
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-YERGDASKEDID, from the internal region of the protein sequence according to NP_005318.2. |
Goat Polyclonal Antibody against SETDB2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence GEKNGDAKTFWME-C, from the N Terminus of the protein sequence according to NP_114121.1. |
Rabbit polyclonal antibody to TMLHE (trimethyllysine hydroxylase, epsilon)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 115 and 397 of TMLHE (Uniprot ID#Q9NVH6) |
Goat Anti-ACAT1 (aa253-266) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DEEYKRVDFSKVPK, from the internal region of the protein sequence according to NP_000010.1. |
Goat Anti-ALDH1B1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DKEQFERVLGYIQ, from the interral region of the protein sequence according to NP_000683.3. |
Rabbit polyclonal anti-TFP1/HADHA antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 750 of human TFP1 |
Anti-HADH Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit anti-BBOX1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human BBOX1 |
Mouse Monoclonal ALDH2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Monkey, Hamster |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALDH2 mouse monoclonal antibody, clone OTI4H2 (formerly 4H2)
Applications | FC, IF |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)
Applications | FC, IF, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI3A11 (formerly 3A11)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI3A8 (formerly 3A8)
Applications | FC, IF, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI5F7 (formerly 5F7)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI7B1 (formerly 7B1)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI3E2 (formerly 3E2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI3C9 (formerly 3C9)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI5C9 (formerly 5C9)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI5A2 (formerly 5A2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI1B7 (formerly 1B7)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |