Rabbit Polyclonal Anti-THOC1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-THOC1 antibody: synthetic peptide directed towards the C terminal of human THOC1. Synthetic peptide located within the following region: TNQQFKSLQEYLENMVIKLAKELPPPSEEIKTGEDEDEEDNDALLKENES |
Rabbit Polyclonal Anti-PSMA1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMA1 antibody: synthetic peptide directed towards the C terminal of human PSMA1. Synthetic peptide located within the following region: TYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDL |
USD 379.00
In Stock
Rabbit Polyclonal Anti-PSMA3 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMA3 antibody: synthetic peptide directed towards the middle region of human PSMA3. Synthetic peptide located within the following region: VKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDN |
Rabbit Polyclonal Anti-PSMD4 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMD4 antibody: synthetic peptide directed towards the N terminal of human PSMD4. Synthetic peptide located within the following region: VLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGL |
Rabbit Polyclonal Anti-PSMC4 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMC4 antibody: synthetic peptide directed towards the N terminal of human PSMC4. Synthetic peptide located within the following region: MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQE |
Rabbit anti-PSMC2 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PSMC2 |
Rabbit anti-PSMC3 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PSMC3 |
Rabbit anti-PSMA1 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PSMA1 |
Rabbit anti-PSMF1 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PSMF1 |
Rabbit anti-PSME2 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PSME2 |
PSME3 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PSME3 |
Rabbit Polyclonal Anti-PSMD11 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PSMD11 Antibody: synthetic peptide directed towards the C terminal of human PSMD11. Synthetic peptide located within the following region: ALRYAGRQTEALKCVAQASKNRSLADFEKALTDYRAELRDDPIISTHLAK |
Rabbit anti-PSMC6 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PSMC6 |
Rabbit anti-PSMB4 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PSMB4 |
Rabbit Polyclonal Anti-PSME1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSME1 antibody: synthetic peptide directed towards the middle region of human PSME1. Synthetic peptide located within the following region: KEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPEI |
USD 475.00
5 Days
Rabbit Polyclonal Anti-PSMD12 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMD12 antibody: synthetic peptide directed towards the middle region of human PSMD12. Synthetic peptide located within the following region: KYKDLLKLFTTMELMRWSTLVEDYGMELRKGSLESPATDVFGSTEEGEKR |
USD 475.00
5 Days
Rabbit Polyclonal Anti-PSMD12 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMD12 antibody: synthetic peptide directed towards the N terminal of human PSMD12. Synthetic peptide located within the following region: MADGGSERADGRIVKMEVDYSATVDQRLPECAKLAKEGRLQEVIETLLSL |
Rabbit Polyclonal Anti-PSMA3 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMA3 antibody: synthetic peptide directed towards the middle region of human PSMA3. Synthetic peptide located within the following region: TCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREE |
Rabbit Polyclonal Anti-PSMC4 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMC4 antibody: synthetic peptide directed towards the N terminal of human PSMC4. Synthetic peptide located within the following region: MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQE |
Rabbit Polyclonal Anti-PSMA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMA1 antibody: synthetic peptide directed towards the N terminal of human PSMA1. Synthetic peptide located within the following region: MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALK |
Rabbit Polyclonal Anti-THOC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-THOC1 antibody is: synthetic peptide directed towards the C-terminal region of Human THOC1. Synthetic peptide located within the following region: NEQESTLGQKHTEDREEGMDVEEGEMGDEEAPTTCSIPIDYNLYRKFWSL |
Rabbit Polyclonal Anti-PSMD8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMD8 antibody: synthetic peptide directed towards the C terminal of human PSMD8. Synthetic peptide located within the following region: DYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV |
Rabbit Polyclonal Anti-PSMD2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMD2 Antibody: A synthesized peptide derived from human PSMD2 |
Rabbit Polyclonal Anti-PSMD2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMD2 Antibody: A synthesized peptide derived from human PSMD2 |
Rabbit Polyclonal Anti-Interferon gamma Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Interferon gamma Antibody: A synthesized peptide derived from human Interferon gamma |
Interferon gamma (IFNG) mouse monoclonal antibody, clone 315, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Goat Polyclonal Antibody against PI31 / PSMF1 (Isoform 1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DHLPPPGYDDMYL, from the C Terminus of the protein sequence according to NP_006805.1; NP_848693.1. |
Goat Polyclonal Antibody against PSME2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NLEKIVNPKGEEKP, from the C Terminus of the protein sequence according to NP_002809.2. |
Rabbit polyclonal antibody to PSMC3 (proteasome (prosome, macropain) 26S subunit, ATPase, 3)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 51 and 361 of PSMC3 (Uniprot ID#P17980) |
Rabbit Polyclonal antibody to Proteasome 20S alpha 2 (proteasome (prosome, macropain) subunit, alpha type, 2)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 234 of Proteasome 20S alpha 2 (Uniprot ID#P25787) |
Rabbit Polyclonal antibody to PSME3 (proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 254 of PSME3 |
Germany
Japan
United Kingdom
China
