Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-HSPA8 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL |
Rabbit Polyclonal Anti-HSPA8 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: VVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAE |
Goat Polyclonal Antibody against PRPF31
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KELGNSLDKCKNNEN, from the internal region of the protein sequence according to NP_056444.2. |
Goat Polyclonal Antibody against HSPA8 (Isoform 1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EKLQGKINDEDKQK, from the internal region of the protein sequence according to NP_006588.1. |
Mouse monoclonal Hsp70/Hsc70 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Bovine, C.elegans, Beluga, Canine, Chicken, Drosophila, Fish, Guinea pig, Hamster, Monkey, Pig, Plant, Rabbit, Sheep, Xenopus |
| Conjugation | Unconjugated |
Rabbit polyclonal Hsp70 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Beluga, Cow, Dog, Fish (carp), Guinea Pig, Hamster, Monkey, Pig, Sheep, Coral, Tomato, Tobacco, Spiny Dogfish Shark (Squalus acanthias), Atlantic Hagfish (Myxine glutinosa) |
| Conjugation | Unconjugated |
| Immunogen | Full length human protein Hsp70 |
U2AF1 Rabbit Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human U2AF1 |
Rabbit anti-SFRS1 Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SFRS1 |
Rabbit anti-SNRPE Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SNRPE |
Rabbit anti-PRPF31 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PRPF31 |
Rabbit anti-LSM4 Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human LSM4 |
Rabbit polyclonal hnRNP K (Ser216) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human hnRNP K around the phosphorylation site of serine 216. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-hnRNP M Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-hnRNP M Antibody: A synthesized peptide derived from human hnRNP M |
Rabbit Polyclonal Anti-hnRNP M Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-hnRNP M Antibody: A synthesized peptide derived from human hnRNP M |
Rabbit Polyclonal Anti-hnRNP C1/2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-hnRNP C1/2 Antibody: A synthesized peptide derived from human hnRNP C1/2 |
Rabbit Polyclonal antibody to PUF60 (poly-U binding splicing factor 60KDa)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 346 and 523 of PUF60 (Uniprot ID#Q9UHX1) |
Rabbit polyclonal anti-THOC4 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human THOC4. |
Rabbit polyclonal anti-NCBP1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human NCBP1. |
Rabbit polyclonal anti-SFRS5 antibody
| Applications | IF |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | he antiserum was produced against synthesized peptide derived from internal of human SFRS5. |
Rabbit polyclonal anti-PRPF18 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PRPF18. |
Rabbit polyclonal anti-BUD31 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human BUD31. |
Rabbit polyclonal anti-CDC40 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CDC40. |
Rabbit Polyclonal hnRNP C1/2 (Ser260) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human hnRNP C1/2 around the phosphorylation site of Serine 260 |
| Modifications | Phospho-specific |
Rabbit polyclonal HSPA8 antibody
| Applications | WB |
| Reactivities | Human Mouse Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human HSPA8. |
Rabbit polyclonal SART1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human SART1. |
Mouse monoclonal anti-HSPA8(HSC70) antibody, clone 1F2-H5, Loading control
| Applications | WB |
| Reactivities | Human, Mouse, Rat. Not yet tested in other species |
| Conjugation | Unconjugated |
HSP70-1A (HSPA1A) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a sequence at the C-terminal of human HSP70s |
Rabbit Polyclonal Antibody against HSPA1A (Y41)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HSPA1A/HSPA1B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 19-48 amino acids from human HSPA1A/HSPA1B. |
Goat Polyclonal Antibody against SIAHBP1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-YDQERFDNSDLSA, from the C Terminus of the protein sequence according to NP_510965.1; NP_055096.2. |
Goat Polyclonal Antibody against SART1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence GSSKKHRGEKEAA-C, from the N Terminus of the protein sequence according to NP_005137.1. |
Goat Anti-MAGOH Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SLIGLHFKIKPI, from the C Terminus of the protein sequence according to NP_002361.1. |
Mouse Monoclonal anti-HSPA8 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Reactivities
- Rat
Pathways
- Spliceosome
Filter by
Category
Target Symbol
- HSPA1A (45)
- DDX39B (38)
- SF3A1 (35)
- SNRPB2 (35)
- HNRNPM (30)
- HSPA1L (26)
- SLU7 (26)
- PPIL1 (25)
- PCBP1 (17)
- HSPA8 (15)
- SRSF9 (15)
- PPIH (10)
- RBM8A (10)
- BCAS2 (7)
- SYF2 (6)
- SF3B6 (5)
- THOC3 (5)
- HNRNPC (4)
- HNRNPK (4)
- SART1 (3)
- SF3B4 (3)
- ACIN1 (2)
- ALYREF (2)
- CTNNBL1 (2)
- HNRNPA1 (2)
- NCBP1 (2)
- PRPF31 (2)
- PUF60 (2)
- RBMX (2)
- SF3B3 (2)
- BUD31 (1)
- CDC40 (1)
- CDC5L (1)
- DDX5 (1)
- LSM2 (1)
- LSM4 (1)
- MAGOH (1)
- PRPF18 (1)
- PRPF3 (1)
- SNRPE (1)
- SNW1 (1)
- SRSF1 (1)
- SRSF5 (1)
- U2AF1 (1)
- WBP11 (1)
- XAB2 (1)