Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Rabbit polyclonal HLA-G Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HLA-G antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the Central region of human HLA-G. |
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ACTB |
TA349205 is a possible alternative to TA349208.
Rabbit Polyclonal Anti-DAF Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DAF antibody was raised against an 18 amino acid peptide near the carboxy terminus of human DAF. The immunogen is located within amino acids 360 - 410 of DAF. |
Rabbit Polyclonal MYH11 Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYH11 antibody: human MYH11 (Myosin, Heavy Chain 11) using two KLH-conjugated synthetic peptides containing sequences from the C-terminal region of the protein. |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Anti-RAC2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 50-192 amino acids of human ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) |
Rabbit Polyclonal Antibody against RAC1 (S71)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RAC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 49-78 amino acids from human RAC1. |
Anti-HLA-DRA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 26-216 amino acids of human major histocompatibility complex, class II, DR alpha |
Rabbit anti-ITGB2 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ITGB2 |
Rabbit Polyclonal Anti-RAC1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAC1 antibody: synthetic peptide directed towards the middle region of human RAC1. Synthetic peptide located within the following region: LAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL |
Rabbit Polyclonal Anti-MYH1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYH1 antibody: synthetic peptide directed towards the N terminal of human MYH1. Synthetic peptide located within the following region: KTSVFVVDPKESFVKATVQSREGGKVTAKTEAGATVTVKDDQVFPMNPPK |
Rabbit Polyclonal Anti-MYH9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYH9 antibody: synthetic peptide directed towards the middle region of human MYH9. Synthetic peptide located within the following region: DAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAK |
Goat Polyclonal Anti-ICAM1 (aa313-327) Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ICAM1 (aa313-327) Antibody: Peptide with sequence C-PNVILTKPEVSEGTE, from the internal region of the protein sequence according to NP_000192.2. |
Rabbit polyclonal Caspase 9 (Tyr153) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of tyrosine 153 (L-A-YP-I-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal CASP8 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CASP8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 432-461 amino acids from the C-terminal region of human CASP8. |
Rabbit Polyclonal Anti-EIF4G2 Antibody
| Applications | WB |
| Reactivities | Chicken, Human, Turkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EIF4G2 antibody: synthetic peptide directed towards the C terminal of human EIF4G2. Synthetic peptide located within the following region: KGFVNILMTSFLQYISSEVNPPSDETDSSSAPSKEQLEQEKQLLLSFKPV |
Goat Polyclonal Antibody against Caveolin 1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DELSEKQVYDAH, from the internal region of the protein sequence according to NP_001744.2. |
HLA-DRA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HLA-DRA |
Rabbit anti-ITGAL Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Protein of human ITGAL |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ACTB |
Active filters
Reactivities
- Human
Pathways
- Viral myocarditis
Filter by
Category
Target Symbol
- CD40 (118)
- CD80 (102)
- BID (58)
- CD86 (58)
- CASP3 (44)
- CCND1 (30)
- SHC1 (30)
- ACTB (28)
- CD28 (28)
- ICAM1 (24)
- CASP9 (19)
- CAV1 (18)
- HLA-A (18)
- SMURF2 (17)
- CYCS (15)
- ABL1 (13)
- CASP8 (13)
- HLA-DQA2 (13)
- PRF1 (13)
- FYN (10)
- CD55 (7)
- EIF4G2 (7)
- CD40LG (6)
- RAC1 (6)
- SGCD (6)
- ACTG1 (5)
- CXADR (5)
- HLA-DRB5 (5)
- HLA-G (5)
- ITGB2 (5)
- MYH1 (5)
- MYH11 (5)
- ITGAL (4)
- DMD (3)
- EIF4G1 (3)
- HLA-B (3)
- HLA-DRA (3)
- HLA-DRB3 (3)
- HLA-E (3)
- MYH7 (3)
- CASPASE 9 (2)
- DAG1 (2)
- EIF4G3 (2)
- HLA-DMB (2)
- HLA-DOB (2)
- HLA-DPA1 (2)
- HLA-DPB1 (2)
- HLA-F (2)
- MYH9 (2)
- RAC2 (2)
- SGCA (2)
- SGCB (2)
- SGCG (2)
- ABL2 (1)
- HLA-C (1)
- HLA-DOA (1)
- HLA-DQB1 (1)
- HLA-DRB1 (1)
- HLA-DRB4 (1)
- LAMA2 (1)
- MYH10 (1)
- MYH13 (1)
- MYH14 (1)
- MYH4 (1)
- MYH6 (1)
- PARVG (1)
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Modifications
Assay Types
Assay Platforms
Families
- Druggable Genome (660)
- Transmembrane (450)
- Transcription Factors (199)
- Secreted Protein (127)
- ES Cell Differentiation/IPS (117)
- Protease (78)
- Stem cell - Pluripotency (56)
- Stem cell relevant signaling - DSL/Notch pathway (30)
- Stem cell relevant signaling - JAK/STAT signaling pathway (30)
- Stem cell relevant signaling - Wnt Signaling pathway (30)
- Protein Kinase (24)
- Adult stem cells (17)