Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
Rabbit Polyclonal Antibody against RAC1 (S71)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RAC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 49-78 amino acids from human RAC1. |
Mouse monoclonal Hsp70/Hsc70 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Bovine, C.elegans, Beluga, Canine, Chicken, Drosophila, Fish, Guinea pig, Hamster, Monkey, Pig, Plant, Rabbit, Sheep, Xenopus |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-TUBE1 Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Drosophila, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TUBE1 antibody: synthetic peptide directed towards the middle region of human TUBE1. Synthetic peptide located within the following region: HLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLSIA |
Rabbit Polyclonal Anti-TPI1 Antibody
| Applications | WB |
| Reactivities | Drosophila, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TPI1 antibody: synthetic peptide directed towards the N terminal of human TPI1. Synthetic peptide located within the following region: MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYID |
Rabbit polyclonal ATP6V1B1 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ATP6V1B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 284-310 amino acids from the Central region of human ATP6V1B1. |
Rabbit Polyclonal antibody to alpha Tubulin 1A (tubulin, alpha 1a)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Drosophila, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 37 and 276 of alpha Tubulin 1A |
Rabbit polyclonal FOXG1 Antibody (Center)
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This FOXG1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 225-252 amino acids from the Central region of human FOXG1. |
Rabbit Polyclonal anti-CALR Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Dog, Chicken, Drosophila, Fish, Guinea Porcine, Hamster, Monkey, Porcine, Rabbit, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Human calreticulin synthetic peptide with a cysteine residue added and the peptide conjugated to KLH |
Rabbit Polyclonal Calnexin Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Chicken, Avian, Drosophila |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the canine Calnexin protein (within residues 25-100). [Swiss-Prot P24643] |
Rabbit Polyclonal Cdc73 Antibody
| Applications | WB |
| Reactivities | Drosophila, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Cdc73 antibody: drosophila Cdc73 (Cell division cycle protein 73), using the full length recombinant protein. |
Rabbit Polyclonal H3K9me3 Antibody
| Applications | WB |
| Reactivities | Drosophila, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K9me3 antibody: the region of histone H3 containing the trimethylated lysine 9 (H3K9me3). |
Rabbit Polyclonal Rtf1 Antibody
| Applications | WB |
| Reactivities | Drosophila |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rtf1 antibody: drosophila Rtf1 (Rtf1, Paf1/RNA polymerase II complex component, homolog), using the full length recombinant protein. |
Rabbit Polyclonal Antibody against MAP2K1 (S217)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This MEK1(MAP2K1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 196-225 amino acids from human MEK1(MAP2K1). |
Rabbit Polyclonal anti-UBB Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Hamster, Rabbit, Guinea Porcine, Bovine, Porcine, Dog, Sheep, Chicken, Xenopus, Drosophila |
| Conjugation | Unconjugated |
| Immunogen | Native bovine Ubiquitin, conjugated to KLH |
Rabbit polyclonal Hsp 90 alpha antibody
| Applications | WB |
| Reactivities | Chicken, Drosophila, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 289-300 of human Hsp90 protein. |
Rabbit Polyclonal Antibody against HSPA1A (Y41)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HSPA1A/HSPA1B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 19-48 amino acids from human HSPA1A/HSPA1B. |
Rabbit Polyclonal anti-CANX Antibody
| Applications | IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Quail, Rabbit, Sheep, Drosophila, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | Dog calnexin C-terminal synthetic peptide conjugated to KLH. Identical to human, mouse and rat calnexin sequences over these residues. |
Rabbit Polyclonal Anti-Erk1/2 Antibody
| Applications | IF, WB |
| Reactivities | Chicken, Drosophila, Human, Mouse, Rat, Sheep, Xenopus, Cow |
| Conjugation | Unconjugated |
| Immunogen | A 35 residue synthetic peptide, corresponding to Erk1 MAP kinase with the CGG spacer group added and the peptide coupled to KLH. |
Mouse Monoclonal SIAH1/2 Antibody (8G7H12)
| Applications | WB |
| Reactivities | Human, Rat, Drosophila, Porcine, Zebrafish, Mouse |
| Conjugation | Unconjugated |
Rabbit Polyclonal RNA Polymerase II/POLR2A [p Thr4] Antibody
| Applications | Dot, WB |
| Reactivities | Human, Chicken, Drosophila, Yeast |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a phosphorylated Threonine (position 4) of the CTD heptad in the human RNA polymerase II protein [UniProt P24928] |
USD 1,140.00
9 Weeks
Rabbit Polyclonal anti-CANX Antibody
| Applications | WB |
| Reactivities | Human, Monkey, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Quail, Rabbit, Sheep, Drosophila, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | Dog calnexin C-terminal synthetic peptide conjugated to KLH. Identical to human, mouse and rat calnexin sequences over these residues. |
Mouse Monoclonal anti-HSPA1A Antibody
| Applications | FC |
| Reactivities | Human, Mouse, Rat, Bovine, dog, Chicken, Drosophila, Fish, Guinea Porcine, Hamster, Monkey, Porcine, Rabbit, Sheep |
| Conjugation | Unconjugated |
USD 424.00
5 Days
Rabbit Polyclonal Ubiquitin Antibody
| Applications | IF |
| Reactivities | Bovine, C. elegans, Chicken, Drosophila, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Gluteraldehyde cross-linked ubiquitin. |
Rabbit polyclonal anti-CASZ1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Drosophila, Chimpanzee and Macaque |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of Human Casz1 protein. |
Rabbit Polyclonal Anti-Calnexin -CT Antibody
| Applications | WB |
| Reactivities | Human, Monkey, Mouse, Rat, Bovine, Chicken (weak), Dog, Guinea pig, Hamster, Pig, Quail, Rabbit, Sheep, Drosophila (weak), Xenopus (weak) |
| Conjugation | Unconjugated |
| Immunogen | Dog Calnexin C-terminal synthetic peptide conjugated to KLH. Identical to human, mouse and rat calnexin sequences over these residues. |
Rabbit polyclonal anti-R Csnk2a1 antibody (N-term)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | This Rat Csnk2a1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 28-50 amino acids from the N-terminal region of Rat Csnk2a1. |
Rabbit Polyclonal GAPDH/G3PDH Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Drosophila, Feline, Porcine, Protozoa |
| Conjugation | Unconjugated |
| Immunogen | Amino acids 73-87 PITIFQERDPSKIKW of glyceraldehyde 3-phosphate dehydrogenase protein were used as the immunogen. |
Rabbit Polyclonal MEK1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Bovine, Canine, Chicken, Drosophila |
| Conjugation | Unconjugated |
| Immunogen | A portion of amino acids 200-250, containing phospho serine residues at positions 218 and 222, of human MEK1 was used as the immunogen. |
Germany
Japan
United Kingdom
China
