Antibodies

View as table Download

AURKA rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human AURKA

AURKA rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human AURKA

AURKA Rabbit Polyclonal Antibody

Applications ELISA, ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Mouse Monoclonal Aurora A Antibody (1F8)

Applications ELISA, FC, WB
Reactivities Human, Rat, Primate
Conjugation Unconjugated
TA336917 is a replacement of AM06572SU-N.

Rabbit Polyclonal Aurora Kinase (Thr288) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Aurora Kinase around the phosphorylation site of Threonine 288
Modifications Phospho-specific

Rabbit Polyclonal Aurora A Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A genomic peptide made to an N-terminal region of the human Aurora A protein (within residues 50-200). [Swiss-Prot O14965]

Rabbit Polyclonal Anti-AurA Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-AurA Antibody: A synthesized peptide derived from human AurA

Rabbit Polyclonal Aurora Kinase Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Aurora Kinase

Phospho-AURKA-T288 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding T288 of human AURKA
Modifications Phospho-specific

Aurora A (AURKA) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 251-300 of Human AURKA.

Rabbit Polyclonal anti-AURKA antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AURKA antibody: synthetic peptide directed towards the C terminal of human AURKA. Synthetic peptide located within the following region: ARDLISRLLKHNPSQRPMLREVLEHPWITANSSKPSNCQNKESASKQS

Rabbit Polyclonal Anti-AURKA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AURKA Antibody is: synthetic peptide directed towards the middle region of Human AURKA. Synthetic peptide located within the following region: REKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYF

Goat Polyclonal Antibody against Aurora kinase A / STK15

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QNKESASKQS, from the C Terminus of the protein sequence according to NP_003591.2.

Aurora Kinase 2 Mouse Monoclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

AURKA rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human AURKA

AURKA Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Modifications Unmodified

Phospho-AURKA-T288 Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Modifications Phospho T288

AURKA/AURKB/AURKC Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 250 to 350 of human AURKA/AURKB/AURKC (NP_003591.2).
Modifications Unmodified

Phospho-AURKA-T288/AURKB-T232/AURKC-T198 Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Rat
Conjugation Unconjugated
Modifications Phospho T288,Phospho T232,Phospho T198