Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal HP1alpha/beta/gamma Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HP1.,.,. antibody: human HP1 . (Heterochromatin protein 1 homolog beta), using the full length recombinant GST tagged protein. The antibody also recognizes the . and . isoforms. |
Rabbit Polyclonal HP1 alpha Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HP1 alpha antibody: human HP1 alpha (Heterochromatin protein 1 homolog alpha), using the full length recombinant GST tagged protein. |
Rabbit Polyclonal HP1 alpha, beta and gamma Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HP1 alpha, beta and gamma antibody: human HP1 beta (Heterochromatin protein 1 homolog beta), using the full length recombinant GST tagged protein. The antibody also recognizes the alpha and gamma isoforms. |
Rabbit polyclonal HP1a (Ser92) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human HP1a around the phosphorylation site of serine 92 (R-K-SP-N-F). |
| Modifications | Phospho-specific |
Rabbit polyclonal CBX5 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CBX5. |
Rabbit Polyclonal Anti-CBX5 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CBX5 antibody: synthetic peptide directed towards the middle region of human CBX5. Synthetic peptide located within the following region: KYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFE |
Anti-CBX5 Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Anti-CBX5 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
HP1 alpha/CBX5 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human HP1 alpha/HP1 alpha/CBX5 (NP_001120794.1). |
| Modifications | Unmodified |
HP1 alpha/CBX5 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-191 of human HP1 alpha/HP1 alpha/CBX5 (NP_001120794.1). |
| Modifications | Unmodified |
HP1 alpha Mouse monoclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HP1 alpha Rabbit polyclonal Antibody
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human HP1 alpha |
Recombinant Anti-CBX5 (Clone RAB-C133)
| Applications | ChIP, ELISA |
| Reactivities | Human |
| Conjugation | His Tag |
Recombinant Anti-CBX5 (Clone RAB-C133)
| Applications | ChIP, ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Human Fab format, for improved compatibility with existing reagents, assays and techniques. |
Active filters
Target Symbol
- CBX5