Germany
Japan
United Kingdom
China
Antibodies
View as table Download
FAS Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FAS |
Mouse Anti-Human CD95 (APO-1/Fas) Purified
| Applications | FC |
| Reactivities | Human |
CD95 (FAS) (Center) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | conjugated synthetic peptide selected from the Center region of human FAS |
CD95 (FAS) (323-327) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Peptide sequence around aa.323~327 derived from human Fas . |
CD95 (FAS) (323-327) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Peptide sequence around aa.323~327 derived from human Fas . |
Goat Anti-FAS / CD95 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KTCRKHRKENQGSH, from the internal region of the protein sequence according to NP_000034.1; NP_690610.1; NP_690611.1. |
Mouse Anti-Mouse CD95 (APO-1/Fas) Purified (50 ug)
| Applications | FC |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-FAIM2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FAIM2 antibody is: synthetic peptide directed towards the N-terminal region of Human FAIM2. Synthetic peptide located within the following region: QVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVD |
Mouse Monoclonal FAS (C-terminus) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti CD95 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FAS mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FAS mouse monoclonal antibody, clone OTI2C2 (formerly 2C2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Fas Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 30-335 of human Fas (NP_000034.1). |
| Modifications | Unmodified |
Fas Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 61-335 of human Fas (NP_000034.1). |
| Modifications | Unmodified |
Phospho-Fas-Y291 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic phosphorylated peptide around Y291 of human FAS (NP_000034.1). |
| Modifications | Phospho Y291 |
Fas Rabbit polyclonal Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human Fas |
Recombinant Anti-Fas (Clone R-125224)
| Applications | ELISA, FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Recombinant Anti-Fas (Clone R-125224)
| Applications | ELISA, FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
sFas Receptor Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Produced from sera of rabbits immunized with highly pure recombinant Human sFas Receptor. Anti-Human sFas Receptor specific antibody was purified by affinity chromatography employing an immobilized Human sFas Receptor matrix. |
sFas Receptor Antibody (biotin)
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Produced from sera of rabbits immunized with highly pure recombinant Human sFas Receptor. Anti-Human sFas Receptor specific antibody was purified by affinity chromatography and then biotinylated. |
FAS mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
FAS mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
FAS mouse monoclonal antibody, clone OTI2C2 (formerly 2C2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
FAS mouse monoclonal antibody, clone OTI2C2 (formerly 2C2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- FAS
Filter by
Category
Reactivities
Antibody Hosts
Isotypes
Clonalities
Conjugates
Modifications
Assay Types
Pathways
- Allograft rejection (19)
- Alzheimer's disease (19)
- Apoptosis (19)
- Autoimmune thyroid disease (19)
- Cytokine-cytokine receptor interaction (19)
- Graft-versus-host disease (19)
- MAPK signaling pathway (19)
- Natural killer cell mediated cytotoxicity (19)
- Pathways in cancer (19)
- Type I diabetes mellitus (19)
- p53 signaling pathway (19)