Antibodies

View as table Download

Rabbit Polyclonal Anti-TARDBP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TARDBP antibody: synthetic peptide directed towards the C terminal of human TARDBP. Synthetic peptide located within the following region: MGMLASQQNQSGPSGNNQNQGNMQREPNQAFGSGNNSYSGSNSGAAIGWG

Rabbit Polyclonal Anti-TARDBP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TARDBP antibody: synthetic peptide directed towards the N terminal of human TARDBP. Synthetic peptide located within the following region: MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQC

Rabbit polyclonal TARDBP Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human, Mouse (Predicted: Chicken)
Conjugation Unconjugated
Immunogen This TARDBP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human TARDBP.

Rabbit anti-TARDBP Polyclonal Antibody

Applications ELISA, IHC, IP, RIP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Antibody against TARDBP

Applications WB
Reactivities Human, Primate, Mouse, Xenopus, Zebrafish, Chicken
Conjugation Unconjugated
Immunogen A synthetic peptide to a C-terminal region [within residues 350-414] of the human TARDBP protein. [Swiss-Prot# Q13148]

Goat Anti-TARDBP Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-HISNAEPKHNSNRQ, from the internal region of the protein sequence according to NP_031401.1.

Rabbit Polyclonal TDP43 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TDP43 antibody was raised against a 15 amino acid peptide from near the amino terminus of human TDP43.

Rabbit Polyclonal TDP43 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TDP43 antibody was raised against a 18 amino acid peptide from near the center of human TDP43.

Rabbit Anti-TDP43 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues C-terminal to the caspase-cleavage site (between D219 and V220) of human TDP-43.

Mouse Monoclonal TARDBP Antibody (3H8)

Applications IF
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-TARDBP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TARDBP antibody: synthetic peptide directed towards the middle region of human TARDBP. Synthetic peptide located within the following region: GISVHISNAEPKHNSNRQLERSGRFGGNPGGFGNQGGFGNSRGGGAGLGN

Rabbit Polyclonal Anti-TARDBP Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TARDBP antibody: synthetic peptide directed towards the N terminal of human TARDBP. Synthetic peptide located within the following region: VYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLK

TDP-43/TARDB Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human TDP-43/TARDB
Modifications Unmodified

TDP-43/TARDB Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human TDP-43/TARDB (NP_031401.1).
Modifications Unmodified

TDP-43/TARDB Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human TDP-43/TARDB (NP_031401.1).
Modifications Unmodified

TDP-43/TARDB Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human TDP-43/TARDB (NP_031401.1).

Phospho-TDP-43/TARDB-S409/S410 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A phospho synthetic peptide corresponding to residues surrounding S409/S410 of Human TDP-43/TARDB.
Modifications Phospho S409/S410

TDP 43 Rabbit polyclonal Antibody

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Zebrafish
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human TDP43