Rabbit Polyclonal Anti-TARDBP Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TARDBP antibody: synthetic peptide directed towards the C terminal of human TARDBP. Synthetic peptide located within the following region: MGMLASQQNQSGPSGNNQNQGNMQREPNQAFGSGNNSYSGSNSGAAIGWG |
Rabbit Polyclonal Anti-TARDBP Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TARDBP antibody: synthetic peptide directed towards the N terminal of human TARDBP. Synthetic peptide located within the following region: MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQC |
Rabbit polyclonal TARDBP Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This TARDBP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human TARDBP. |
Rabbit anti-TARDBP Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TARDBP |
Rabbit Polyclonal Antibody against TARDBP
| Applications | WB |
| Reactivities | Human, Primate, Mouse, Xenopus, Zebrafish, Chicken |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide to a C-terminal region [within residues 350-414] of the human TARDBP protein. [Swiss-Prot# Q13148] |
Goat Anti-TARDBP Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HISNAEPKHNSNRQ, from the internal region of the protein sequence according to NP_031401.1. |
Rabbit Anti-TDP43 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to amino acid residues C-terminal to the caspase-cleavage site (between D219 and V220) of human TDP-43. |
Mouse Monoclonal TARDBP Antibody (3H8)
| Applications | IF |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-TARDBP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TARDBP antibody: synthetic peptide directed towards the middle region of human TARDBP. Synthetic peptide located within the following region: GISVHISNAEPKHNSNRQLERSGRFGGNPGGFGNQGGFGNSRGGGAGLGN |
Rabbit Polyclonal Anti-TARDBP Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TARDBP antibody: synthetic peptide directed towards the N terminal of human TARDBP. Synthetic peptide located within the following region: VYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLK |
TDP-43/TARDB Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human TDP-43/TARDB |
| Modifications | Unmodified |
TDP-43/TARDB Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human TDP-43/TARDB (NP_031401.1). |
| Modifications | Unmodified |
TDP-43/TARDB Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human TDP-43/TARDB (NP_031401.1). |
| Modifications | Unmodified |
TDP-43/TARDB Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human TDP-43/TARDB (NP_031401.1). |
Phospho-TDP-43/TARDB-S409/S410 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A phospho synthetic peptide corresponding to residues surrounding S409/S410 of Human TDP-43/TARDB. |
| Modifications | Phospho S409/S410 |
TDP 43 Rabbit polyclonal Antibody
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human TDP43 |
Germany
Japan
United Kingdom
China
