Antibody Sample

View as table Download

Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal PD-L1 Antibody

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1.

Rabbit monoclonal antibody against PTEN Phospho (Ser380) (clone EPR2062Y ) (Phospho-Specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications Phospho-specific

CD274 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CD274

Rabbit polyclonal TGFBR2 (Ab-250) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human TGFBR2 around the phosphorylation site of serine 250 (D-R-SP-D-I).

CD274 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CD274

HLA-A rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human HLA-A

Rabbit Polyclonal PDL-2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PDL-2 antibody was raised against a 16 amino acid peptide from near the center of human PDL-2.

Rabbit Polyclonal Caspase-8 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Caspase-8 antibody was raised against a 16 amino acid peptide from near the carboxy-terminus of human Caspase-8 isoform A.

Rabbit polyclonal TGFBR2 Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This TGFBR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-40 amino acids from the N-terminal region of human TGFBR2.

Rabbit polyclonal anti-HER3 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human HER3.

Rabbit polyclonal CASP8 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CASP8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 432-461 amino acids from the C-terminal region of human CASP8.

Rabbit Polyclonal FLIP Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen FLIP antibody was raised against a peptide corresponding to amino acids near the C-terminus of human FLIPaFLIPl form. The immunogen is located within the last 50 amino acids of FLIP.

Rabbit Polyclonal FLASH Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen FLASH antibody was raised against a synthetic peptide corresponding to amino acids near the carboxy-terminus of human FLASH which differ from those of mouse by one amino acid.

Rabbit anti-ANXA2 (Annexin A2) polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen a 16 amino acid peptide from near the N terminal residues of human Annexin A2 protein

Rabbit monoclonal antibody against HER3/ErbB3 Phospho (pY1289) (EPR2325 ) (phospho-specific)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Modifications Phospho-specific

Rabbit Polyclonal FLIP Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen FLIP antibody was raised against a 19 amino acid peptide near the carboxy terminus of human FLIP. The immunogen is located within amino acids 180 - 230 of FLIP.

Rabbit polyclonal anti-HER3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Anti-HER3 whole rabbit serum was prepared by repeated immunizations with a HER3 fusion protein corresponding to amino acids 1283 to 1323 (40 amino acids) at the carboxy-terminus of human HER3.

Rabbit polyclonal Caspase 8 (Tyr380) antibody(Phospho-specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Caspase 8 around the phosphorylation site of tyrosine 380 (Q-P-YP-L-E).
Modifications Phospho-specific

Rabbit polyclonal PTEN (Ab-370) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This antiserum was produced against synthesized non-phosphopeptide derived from human PTEN around the phosphorylation site of serine 370.

Rabbit polyclonal anti-MED1 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MED1.

Rabbit polyclonal TTR Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This TTR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 71-98 amino acids from the C-terminal region of human TTR.

Rabbit Polyclonal Caspase 8 (Ser347) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Caspase 8 around the phosphorylation site of Serine 347
Modifications Phospho-specific

HLA-A/B/C rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human HLA-A/B/C

CD274 rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CD274

CD274 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CD274

Rabbit Polyclonal ErbB3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. In vivo generated recombinant protein fragment

Rabbit Polyclonal FLIP Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen FLIP antibody was raised against a peptide corresponding to 17 amino acids near the amino terminus of human FLIP. The sequence is identical in all FLIP splice variants. The immunogen is located within the first 50 amino acids of FLIP.

Rabbit polyclonal antibody to DEDD (death effector domain containing)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 129 and 223 of DEDD (Uniprot ID#O75618)

Rabbit polyclonal CASP8 (Cleaved-Asp384) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human CASP8.

Rabbit Polyclonal Caspase 8 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Caspase 8

Rabbit Polyclonal PPAR-BP Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human PPAR-BP

Rabbit Polyclonal PPAR-BP (Thr1457) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human PPAR-BP around the phosphorylation site of Threonine 1457
Modifications Phospho-specific

Rabbit polyclonal ANXA2 (Phospho-Ser26) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human ANXA2 around the phosphorylation site of serine 26.
Modifications Phospho-specific

Rabbit Polyclonal Phospho-PTEN (Ser370) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human PTEN around the phosphorylation site of Serine 370
Modifications Phospho-specific

Rabbit Polyclonal PTEN Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human PTEN

Rabbit Polyclonal Anti-ANXA2R Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ANXA2R antibody: synthetic peptide directed towards the N terminal of human ANXA2R. Synthetic peptide located within the following region: EQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDS

PINK1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit Polyclonal PTEN Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen PTEN antibody was raised against a 15 amino acid peptide from near the amino terminus of human PTEN.

Rabbit polyclonal antibody to SHKBP1 (SH3KBP1 binding protein 1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 162 and 477 of SHKBP1 (Uniprot ID#Q8TBC3)

Rabbit anti-PTEN (Phospho-Ser380/Thr382/Thr383) polyclonal antibody (Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse and Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanPTEN around the phosphorylation site of serine 380 and threonine 382/383(R-Y-SP-D-TP-TP-D-S).
Modifications Phospho-specific

Rabbit polyclonal PTEN(Ab-380/382/383) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human PTEN around the phosphorylation site of Serine 380 and Threonine 382/383.

Rabbit Polyclonal ApoA1 Antibody

Applications WB
Reactivities Chicken, Human
Conjugation Unconjugated
Immunogen ApoA1 antibody was raised against a 19 amino acid synthetic peptide near the carboxy terminus of human ApoA1.

Rabbit anti-SERPINA1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SERPINA1

Rabbit polyclonal Anti-TPTE Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TPTE antibody: synthetic peptide directed towards the middle region of human TPTE. Synthetic peptide located within the following region: YFAQVKHLYNWNLPPRRILFIKHFIIYSIPRYVRDLKIQIEMEKKVVFST

Rabbit Polyclonal Anti-MBD4 Antibody

Applications Assay, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MBD4 antibody: synthetic peptide directed towards the middle region of human MBD4. Synthetic peptide located within the following region: CSEQKTSGIINKFCSAKDSEHNEKYEDTFLESEEIGTKVEVVERKEHLHT

Rabbit Polyclonal Anti-TPTE Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TPTE antibody: synthetic peptide directed towards the C terminal of human TPTE. Synthetic peptide located within the following region: KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL