Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5H8
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5H8
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5H8
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E3
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E3
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal PD-L1 Antibody
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
CD274 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CD274 |
Rabbit Polyclonal PDL-2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PDL-2 antibody was raised against a 16 amino acid peptide from near the center of human PDL-2. |
Goat Polyclonal Antibody against PD-L1 / CD274
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CKKQSDTHLEET, from the C Terminus of the protein sequence according to NP_054862.1. |
Mouse Monoclonal Anti-PD-L2 Antibody [4E10]
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-PD-L2 Antibody [8C12]
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-PD-L2 Antibody [7C7]
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-PD-L2 Antibody [7C1]
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-PD-L2 Antibody [10H6]
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-PD-L1 Antibody [4F2]
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-PD-L1 Antibody [8E12]
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-PD-L1 Antibody [6H10]
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-PD-L1 Antibody [2D6]
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-PD-L1 Antibody [1F11]
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-PD-L1 Antibody [1D7]
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-HLA-A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HLA-A antibody is: synthetic peptide directed towards the N-terminal region of Human HLA-A. Synthetic peptide located within the following region: SDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQ |
Mouse anti MHC I (HLA-A,B,C) Monoclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Mouse monoclonal Anti-PD-L1 Antibody
Reactivities | Cross-reacts with Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD274 mouse monoclonal antibody, clone OTI1B12 (formerly 1B12)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD274 mouse monoclonal antibody, clone OTI2C7 (formerly 2C7)
Applications | ELISA, FC, IF, LMNX, WB |
Reactivities | Human, not react with Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD274 mouse monoclonal antibody, clone OTI4D4 (formerly 4D4)
Applications | ELISA, LMNX, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) CD274 mouse monoclonal antibody, clone OTI2E3 (formerly 2E3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD274 mouse monoclonal antibody, clone OTI2B12 (formerly 2B12)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PDCD1LG2 mouse monoclonal antibody, clone OTI10G2 (formerly 10G2)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PDCD1LG2 mouse monoclonal antibody, clone OTI8A4 (formerly 8A4)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PDCD1LG2 mouse monoclonal antibody, clone OTI11F9 (formerly 11F9)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PDCD1LG2 mouse monoclonal antibody, clone OTI8G8 (formerly 8G8)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PDCD1LG2 mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD274 mouse monoclonal antibody, clone OTI9E12 (formerly 9E12)
Applications | ELISA, FC, IF, LMNX, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PDCD1LG2 mouse monoclonal antibody,clone OTI1B5
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PDCD1LG2 mouse monoclonal antibody, clone OTI5E5 (formerly 5E5)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PDCD1LG2 mouse monoclonal antibody, clone OTI12C7 (formerly 12C7)
Applications | FC, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PDCD1LG2 mouse monoclonal antibody, clone OTI6C3 (formerly 6C3)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PDCD1LG2 mouse monoclonal antibody, clone OTI7B10 (formerly 7B10)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PDCD1LG2 mouse monoclonal antibody, clone OTI6H10 (formerly 6H10)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PDCD1LG2 mouse monoclonal antibody, clone OTI5A7 (formerly 5A7)
Applications | FC, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PDCD1LG2 mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD274 mouse monoclonal antibody,clone OTI13G7
Applications | ELISA, FC, IF |
Reactivities | Human, not react with Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD274 mouse monoclonal antibody,clone OTI9E10
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD274 mouse monoclonal antibody,clone OTI20G10
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD274 mouse monoclonal antibody,clone OTI16H9
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD274 mouse monoclonal antibody,clone OTI12G7
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD274 mouse monoclonal antibody,clone OTI2F5
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD274 mouse monoclonal antibody,clone OTI11G4
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |