Germany
Japan
United Kingdom
China
B Cell Lineage
Download
USD 428.00
In Stock
Rabbit polyclonal HLA-G Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HLA-G antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the Central region of human HLA-G. |
C Reactive Protein (CRP) mouse monoclonal antibody, clone C7
| Applications | ELISA, IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
Goat Polyclonal Antibody against CRP2 / CSRP2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-ERLGIKPESVQP, from the internal region of the protein sequence according to NP_001312.1. |
Rabbit polyclonal IL1R Antibody (C-term E487)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL1R antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 474-503 amino acids from the C-terminal region of human IL1R. |
Goat Anti-IL18 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NPPDNIKDTKSDI, from the internal region of the protein sequence according to NP_001553.1. |
Rabbit polyclonal antibody to CD74 (CD74 molecule, major histocompatibility complex, class II invariant chain)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 58 of CD74 (Uniprot ID#P04233) |
HLA Class I ABC mouse monoclonal antibody, clone LY5.1, Purified
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal IL-1RAcP Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | IL-1RAcP antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of IL-1RAcP, which differs from the sequence of mouse origin by three amino acids. |
Rabbit polyclonal Myosin 1G antibody
| Applications | WB |
| Reactivities | Chimpanzee, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human Myosin 1G protein. |
Rabbit Polyclonal C/EBP- beta (Thr235/188) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human C/EBP- beta around the phosphorylation site of Threonine 235/188 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-HMHA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HMHA1 antibody is: synthetic peptide directed towards the N-terminal region of Human HMHA1. Synthetic peptide located within the following region: MMHMQTAPLPVHFQMLCESSKLYDPGQQYASHVRQLQRDQEPDVHYDFEP |
Rabbit Polyclonal antibody to IL1ra antagonist (interleukin 1 receptor antagonist)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 177 of IL1ra antagonist (Uniprot ID#P18510) |
Rabbit polyclonal Estrogen Receptor-a (Ab-537) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Estrogen Receptor-a around the phosphorylation site of tyrosine 537 (P-L-YP-D-L). |
Rabbit polyclonal Estrogen Receptor-a (Tyr537) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ER-a around the phosphorylation site of tyrosine 537 (P-L-YP-D-L). |
| Modifications | Phospho-specific |
Active filters
Reactivities
- Human
Filter by
Target Symbol
- IL6 (136)
- IL1RL1 (110)
- ESR1 (67)
- TNF (62)
- CRP (43)
- IL1RN (43)
- ESR2 (32)
- AGTPBP1 (27)
- IL36A (24)
- HLA-A (22)
- CALR (21)
- IL1B (20)
- CD74 (19)
- CASP1 (15)
- CRYGD (15)
- HLA-DQA2 (14)
- TMED1 (14)
- IL36G (13)
- TOLLIP (13)
- IL6R (12)
- CEBPB (11)
- IL1A (11)
- IL33 (11)
- IL18 (10)
- CEBPD (9)
- IL6ST (9)
- HLA-B (7)
- HLA-DRB1 (7)
- IL1RAP (7)
- RAB3IL1 (7)
- CSRP2 (6)
- CSRP3 (6)
- HLA-DMB (6)
- HLA-DRB3 (6)
- HLA-DRB5 (6)
- HLA-E (6)
- IL1R2 (6)
- GZMH (5)
- HLA-DPB1 (5)
- HLA-DQB1 (5)
- HLA-G (5)
- IL18R1 (5)
- IL1R1 (5)
- IL1RL2 (5)
- IL36RN (5)
- AGBL3 (4)
- AGBL5 (4)
- CEBPE (4)
- ENTPD6 (4)
- HLA-C (4)
- HLA-DOA (4)
- HLA-DOB (4)
- HLA-DRA (4)
- IL18RAP (4)
- IL1RAPL2 (4)
- IL37 (4)
- STK19 (4)
- AGBL2 (3)
- ARHGAP45 (3)
- CCP110 (3)
- CRIP1 (3)
- CRIP2 (3)
- GNAO1 (3)
- HFE (3)
- HLA-DPA1 (3)
- HLA-DQA1 (3)
- HLA-DRB4 (3)
- IL36B (3)
- RFX5 (3)
- CCNL2 (2)
- CSRP1 (2)
- HLA CLASS II (2)
- HLA-A/B/C (2)
- HLA-F (2)
- IL1F10 (2)
- IL1RAPL1 (2)
- AGBL1 (1)
- AGBL4 (1)
- CCDC115 (1)
- CCPG1 (1)
- HLA-A/F/H (1)
- HLA-DQB2 (1)
- IK (1)
- IL-1 BETA (1)
- MYO1G (1)
- PUM3 (1)
- SIGIRR (1)
Species
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
- Unmodified (46)
- Phospho-specific (12)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. (3)
- This chimeric mouse antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (2)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (2)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. (2)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG1 format, for improved compatibility with existing reagents, assays and techniques. (2)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric mouse antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This is a chimeric antibody created for improved compatibility with existing reagents, assays and techniques. (1)
- Phospho T235 (1)
- This is a chimeric antibody created for improved compatibility with existing reagents, assays and techniques. (1)
Assay Types
Assay Platforms
Families
Pathways
- Graft-versus-host disease (254)
- Cytokine-cytokine receptor interaction (233)
- Hematopoietic cell lineage (224)
- NOD-like receptor signaling pathway (202)
- Toll-like receptor signaling pathway (201)
- Hypertrophic cardiomyopathy (HCM) (175)
- Cytosolic DNA-sensing pathway (161)
- Prion diseases (150)
- Jak-STAT signaling pathway (140)
- Pathways in cancer (128)
- Type I diabetes mellitus (126)
- Allograft rejection (104)
- Antigen processing and presentation (94)
- MAPK signaling pathway (79)
- Asthma (78)
- Systemic lupus erythematosus (78)
- Apoptosis (76)
- Natural killer cell mediated cytotoxicity (71)
- Alzheimer's disease (60)
- Amyotrophic lateral sclerosis (ALS) (58)
- Autoimmune thyroid disease (57)
- Cell adhesion molecules (CAMs) (57)
- Viral myocarditis (57)
- Adipocytokine signaling pathway (47)
- Dilated cardiomyopathy (47)
- Fc epsilon RI signaling pathway (47)
- RIG-I-like receptor signaling pathway (47)
- T cell receptor signaling pathway (47)
- TGF-beta signaling pathway (47)
- Type II diabetes mellitus (47)
- Endocytosis (26)
- Long-term depression (3)
- Melanogenesis (3)
- Primary immunodeficiency (3)
- Purine metabolism (2)
- Pyrimidine metabolism (2)