Germany
Japan
United Kingdom
China
CRIP1 (Myc-DDK-tagged)-Human cysteine-rich protein 1 (intestinal) (CRIP1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
B Cell Lineage
View as table Download
Lenti ORF particles, CRIP1 (Myc-DDK tagged) - Human cysteine-rich protein 1 (intestinal) (CRIP1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
Lenti ORF particles, CRIP1 (mGFP-tagged) - Human cysteine-rich protein 1 (intestinal) (CRIP1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
Crip1 (Myc-DDK-tagged) - Mouse cysteine-rich protein 1 (intestinal) (Crip1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CRIP1 (GFP-tagged) - Human cysteine-rich protein 1 (intestinal) (CRIP1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CRIP1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN401217 is the updated version of KN201217.
Crip1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN503826 is the updated version of KN303826.
Crip1 (GFP-tagged) - Mouse cysteine-rich protein 1 (intestinal) (Crip1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Crip1 (Myc-DDK-tagged) - Mouse cysteine-rich protein 1 (intestinal) (Crip1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Crip1 (Myc-DDK-tagged) - Mouse cysteine-rich protein 1 (intestinal) (Crip1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
Lenti ORF clone of Crip1 (mGFP-tagged) - Mouse cysteine-rich protein 1 (intestinal) (Crip1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Crip1 (GFP-tagged) - Mouse cysteine-rich protein 1 (intestinal) (Crip1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
Lenti ORF clone of Human cysteine-rich protein 1 (intestinal) (CRIP1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CRIP1 (Myc-DDK tagged) - Human cysteine-rich protein 1 (intestinal) (CRIP1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
Lenti ORF clone of Human cysteine-rich protein 1 (intestinal) (CRIP1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CRIP1 (mGFP-tagged) - Human cysteine-rich protein 1 (intestinal) (CRIP1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
Crip1 (Myc-DDK-tagged ORF) - Rat cysteine-rich intestinal protein (Crip), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Crip1 (Myc-DDK-tagged ORF) - Rat cysteine-rich intestinal protein (Crip), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Crip1 (Myc-DDK-tagged ORF) - Rat cysteine-rich intestinal protein (Crip), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
Lenti ORF clone of Crip1 (mGFP-tagged ORF) - Rat cysteine-rich intestinal protein (Crip), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Crip1 (GFP-tagged ORF) - Rat cysteine-rich intestinal protein (Crip), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
Crip1 (myc-DDK-tagged) - Rat cysteine-rich protein 1 (intestinal) (Crip1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human cysteine-rich protein 1 (intestinal) (CRIP1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
CRIP1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
CRIP1 (untagged)-Human cysteine-rich protein 1 (intestinal) (CRIP1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
qSTAR qPCR primer pairs against Mus musculus gene Crip1
Rabbit Polyclonal Anti-CRIP1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CRIP1 antibody: synthetic peptide directed towards the N terminal of human CRIP1. Synthetic peptide located within the following region: MPKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKP |
Rabbit Polyclonal Anti-CRIP1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CRIP1 antibody: synthetic peptide directed towards the middle region of human CRIP1. Synthetic peptide located within the following region: PCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHTF |
Cysteine-rich protein 1 (1-77, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
Cysteine-rich protein 1 (1-77, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
CRIP1 CRISPRa kit - CRISPR gene activation of human cysteine rich protein 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Crip1 CRISPRa kit - CRISPR gene activation of mouse cysteine-rich protein 1 (intestinal)
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene CRIP1
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene CRIP1
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
CRIP1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Transient overexpression lysate of cysteine-rich protein 1 (intestinal) (CRIP1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Crip1 (untagged) - Mouse cysteine-rich protein 1 (intestinal) (Crip1), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
CRIP1 MS Standard C13 and N15-labeled recombinant protein (NP_001302)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Crip1 (untagged ORF) - Rat cysteine-rich intestinal protein (Crip), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Crip1 (untagged) - Rat cysteine-rich protein 1 (intestinal) (Crip1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of cysteine-rich protein 1 (intestinal) (CRIP1) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Crip1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Crip1 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
CRIP1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-77 of human CRIP1 (NP_001302.1). |
| Modifications | Unmodified |
CRIP1 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
CRIP1 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Crip1 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Crip1 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Crip1 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Crip - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Active filters
Target Symbol
- CRIP1