SARS S mouse monoclonal antibody, clone 4A6C9, Supernatant
Applications | ELISA, WB |
SARS S mouse monoclonal antibody, clone 4A6C9, Supernatant
Applications | ELISA, WB |
SARS M mouse monoclonal antibody, clone 2H2C4, Supernatant
Applications | ELISA, WB |
Feline Coronavirus mouse monoclonal antibody, clone FIPV3-70, Purified
Applications | ELISA, FC, IF, IHC, WB |
Rabbit Polyclonal Anti-MASP2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MASP2 antibody: synthetic peptide directed towards the N terminal of human MASP2. Synthetic peptide located within the following region: FPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAK |
MHV NSP9 (Strain A59) mouse monoclonal antibody, clone 2C6.H1, Purified
Applications | IF, WB |
Reactivities | Mouse |
SARS M (C-term) rabbit polyclonal antibody, Serum
Applications | EM, IF, IP, WB |
Immunogen | BSAcoupled Synthetic peptide corresponding to the C-terminus (amino acid residues 204-221) of the SARS Coronavirus Membrane protein |
Rabbit Polyclonal Anti-ACE2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACE2 Antibody: A synthesized peptide |
Angiotensin Converting Enzyme 2 (ACE2) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide corresponding to amino acids near the center of human ACE2. The immunogen is located within aa 180-230 of ACE2. |
Rabbit Polyclonal Anti-Masp2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Masp2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: YPQPYPKLSSCTYSIRLEDGFSVILDFVESFDVETHPEAQCPYDSLKIQT |
Rabbit Polyclonal Anti-CD147 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD147 Antibody: A synthesized peptide derived from human CD147 |
SARS N rabbit polyclonal antibody, Purified
Applications | ELISA, WB |
Immunogen | Recombinant protein corresponding to full length SARS Coronavirus Nucleocapsid protein |
Angiotensin Converting Enzyme 2 (ACE2) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | ACE2 antibody was raised against synthetic peptide |
USD 440.00
2 Weeks
Angiotensin Converting Enzyme 2 (ACE2) (N-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | ACE2 antibody was raised against synthetic peptide |
USD 475.00
2 Weeks
Angiotensin Converting Enzyme 2 (ACE2) (C-term) mouse monoclonal antibody, clone 11A31, Purified
Applications | IHC, WB |
Reactivities | Human |
Angiotensin Converting Enzyme 2 (ACE2) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide corresponding to a sequence within the amino terminus of Human ACE2. |
Angiotensin Converting Enzyme 2 (ACE2) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |