Germany
Japan
United Kingdom
China
Research Areas
View as table Download
USD 428.00
In Stock
Calreticulin (CALR) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, FC, IHC, WB |
| Reactivities | Human, Rat |
| Immunogen | This CALR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 277-305 amino acids from the Central region of Human CALR. |
Rabbit polyclonal Estrogen Receptor-a (Ab-537) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Estrogen Receptor-a around the phosphorylation site of tyrosine 537 (P-L-YP-D-L). |
Rabbit polyclonal Estrogen Receptor-a (Tyr537) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ER-a around the phosphorylation site of tyrosine 537 (P-L-YP-D-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal Phospho-cJun(S63) Antibody
| Applications | Dot, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This cJun Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S63 of human cJun. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-TCF21 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TCF21 Antibody: synthetic peptide directed towards the N terminal of human TCF21. Synthetic peptide located within the following region: SNCENGSPQKGRGGLGKRRKAPTKKSPLSGVSQEGKQVQRNAANARERAR |
Rabbit polyclonal Estrogen Receptor-a (Ser102) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Estrogen Receptor-a around the phosphorylation site of serine 102 (L-N-SP-V-S). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-LEF1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LEF1 antibody: synthetic peptide directed towards the C terminal of human LEF1. Synthetic peptide located within the following region: VKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQ |
Rabbit Polyclonal Anti-RORA Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RORA antibody: synthetic peptide directed towards the middle region of human RORA. Synthetic peptide located within the following region: GHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFP |
Rabbit anti-ESR2 (Estrogen Receptor-beta, Phospho-Ser118) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human and Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanEstrogen Receptor-α around the phosphorylation site of serine 118 (Q-L-SP-P-F). |
| Modifications | Phospho-specific |
Rabbit anti-ESR2 (Estrogen Receptor-beta, Phospho-Ser167) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanEstrogen Receptor-α around the phosphorylation site of serine 167 (L-A-SP-T-N). |
| Modifications | Phospho-specific |
Rabbit polyclonal C/EBP-beta (Ab-235/188) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human C/EBP-β around the phosphorylation site of threonine 235 (P-G-T-P-S). |
Rabbit Polyclonal Anti-RORA Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RORA antibody: synthetic peptide directed towards the N terminal of human RORA. Synthetic peptide located within the following region: FGILQILHQCILSSGDAFVLTGVCCSWRQNGKPPYSQKEDKEVQTGYMNA |
Rabbit Polyclonal Anti-NFATC3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NFATC3 antibody: synthetic peptide directed towards the N terminal of human NFATC3. Synthetic peptide located within the following region: AVFPFQYCVETDIPLKTRKTSEDQAAILPGKLELCSDDQGSLSPARETSI |
Rabbit anti Estrogen Receptor alpha (ER-alpha) Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the C-terminus of human estrogen receptor protein. This sequence is identical to human, Gorilla, Bovine, etc. |
Estrogen Receptor 1 (ESR1) pSer104 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
Estrogen Receptor 1 (ESR1) pSer118 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
Estrogen Receptor 1 (ESR1) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
Estrogen Receptor 1 (ESR1) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
Estrogen Receptor 1 (ESR1) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
Anti-CEBPD Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 210-225 amino acids of Human CCAAT/enhancer-binding protein delta |
Rabbit Polyclonal Anti-ESR2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ESR2 |
Rabbit Polyclonal Anti-CEBPB Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CEBPB |
USD 180.00
In Stock
Active filters
Applications
- IHC
Antibody Hosts
- Rabbit
Families
- Transcription Factors
Filter by
Category
Target Symbol
Reactivities
Isotypes
Clonalities
Conjugates
Modifications
Pathways
- T cell receptor signaling pathway (8)
- MAPK signaling pathway (7)
- Natural killer cell mediated cytotoxicity (7)
- Toll-like receptor signaling pathway (7)
- Adipocytokine signaling pathway (6)
- Allograft rejection (6)
- Alzheimer's disease (6)
- Amyotrophic lateral sclerosis (ALS) (6)
- Apoptosis (6)
- Asthma (6)
- Cytokine-cytokine receptor interaction (6)
- Dilated cardiomyopathy (6)
- Fc epsilon RI signaling pathway (6)
- Graft-versus-host disease (6)
- Hematopoietic cell lineage (6)
- Hypertrophic cardiomyopathy (HCM) (6)
- NOD-like receptor signaling pathway (6)
- RIG-I-like receptor signaling pathway (6)
- Systemic lupus erythematosus (6)
- TGF-beta signaling pathway (6)
- Type I diabetes mellitus (6)
- Type II diabetes mellitus (6)
- Wnt signaling pathway (4)
- Colorectal cancer (3)
- Pathways in cancer (3)
- Acute myeloid leukemia (2)
- Adherens junction (2)
- Antigen processing and presentation (2)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (2)
- B cell receptor signaling pathway (2)
- Basal cell carcinoma (2)
- Endometrial cancer (2)
- Melanogenesis (2)
- Prostate cancer (2)
- Thyroid cancer (2)
- Axon guidance (1)
- Epithelial cell signaling in Helicobacter pylori infection (1)
- ErbB signaling pathway (1)
- Focal adhesion (1)
- GnRH signaling pathway (1)
- Neurotrophin signaling pathway (1)
- Renal cell carcinoma (1)
- VEGF signaling pathway (1)