Germany
Japan
United Kingdom
China
Research Areas
View as table Download
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal PD-L1 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
USD 428.00
In Stock
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Rabbit Polyclonal Anti-FZD7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD7 antibody: synthetic peptide directed towards the C terminal of human FZD7. Synthetic peptide located within the following region: PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV |
Rabbit Polyclonal Antibody against CD19 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD19 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 143-172 amino acids from the N-terminal region of human CD19. |
Rabbit polyclonal PECAM-1 (Ab-713) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185 |
| Modifications | Phospho-specific |
Rabbit polyclonal ROR2 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ROR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 19-50 amino acids from the N-terminal region of human ROR2. |
Rabbit Polyclonal CD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
Rabbit polyclonal IL1R Antibody (C-term E487)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL1R antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 474-503 amino acids from the C-terminal region of human IL1R. |
Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA |
Rabbit Polyclonal Anti-FZD9 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD9 antibody: synthetic peptide directed towards the N terminal of human FZD9. Synthetic peptide located within the following region: RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF |
Rabbit Polyclonal Anti-WNT3A Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT3A antibody: synthetic peptide directed towards the N terminal of human WNT3A. Synthetic peptide located within the following region: MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP |
Rabbit Polyclonal Anti-MASP2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MASP2 antibody: synthetic peptide directed towards the N terminal of human MASP2. Synthetic peptide located within the following region: FPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAK |
Rabbit polyclonal antibody to CD41/Integrin alpha 2b (integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 210 and 532 of Integrin alpha 2b (Uniprot ID#P08514) |
Rabbit polyclonal antibody to CD74 (CD74 molecule, major histocompatibility complex, class II invariant chain)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 58 of CD74 (Uniprot ID#P04233) |
Rabbit Polyclonal Antibody against CD8A (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 59-88 amino acids from the N-terminal region of human CD8A. |
USD 515.00
In Stock
Rabbit polyclonal PECAM-1 (Tyr713) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-APC10 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids near the amino terminus of human APC10. |
Rabbit Polyclonal ROCK1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ROCK1 |
Active filters
Category
-
Antibodies
- Primary Antibodies
Antibody Hosts
- Rabbit
Families
- Druggable Genome
Filter by
Target Symbol
- ESR1 (22)
- MAPK8 (20)
- ROCK2 (14)
- KIT (13)
- RORA (11)
- WNT1 (9)
- CASP1 (7)
- CD19 (7)
- CD274 (7)
- CEBPB (7)
- MME (7)
- PECAM1 (7)
- TLR4 (7)
- FZD2 (6)
- FZD4 (6)
- FZD9 (6)
- IL2RA (6)
- IL6ST (6)
- ROCK1 (6)
- TLR2 (6)
- TLR3 (6)
- TNF (6)
- WNT3A (6)
- WNT4 (6)
- ANAPC10 (5)
- ANAPC5 (5)
- CD8A (5)
- CEBPD (5)
- DVL2 (5)
- ESR2 (5)
- FZD1 (5)
- FZD10 (5)
- FZD8 (5)
- IL18R1 (5)
- IL1RN (5)
- ITGAX (5)
- ITGB3 (5)
- LEF1 (5)
- LRP5 (5)
- TLR8 (5)
- FZD3 (4)
- FZD5 (4)
- FZD6 (4)
- IL1B (4)
- IL1R1 (4)
- IL6 (4)
- LRP6 (4)
- MAPK9 (4)
- PTPRC (4)
- ROR1 (4)
- TCF4 (4)
- TCF7L2 (4)
- TLR5 (4)
- TLR6 (4)
- TLR7 (4)
- TSLP (4)
- AGBL2 (3)
- ANPEP (3)
- APC2 (3)
- CD14 (3)
- CR2 (3)
- DVL3 (3)
- IL10 (3)
- IL1RL1 (3)
- IL4 (3)
- MAPK10 (3)
- PDCD1 (3)
- ROR2 (3)
- TCF21 (3)
- TLR1 (3)
- TNFRSF8 (3)
- WNT5A (3)
- ACE2 (2)
- CALR (2)
- CD34 (2)
- CD3D (2)
- CD4 (2)
- CD46 (2)
- CXCL8 (2)
- FRZB (2)
- GZMH (2)
- IL1R2 (2)
- IL36G (2)
- IL36RN (2)
- ITGA2B (2)
- MAP2K4 (2)
- NCAM1 (2)
- POSTN (2)
- PTK7 (2)
- TNFRSF1B (2)
- WNT7A (2)
- ANAPC11 (1)
- ANAPC2 (1)
- BDNF (1)
- CCL3 (1)
- CD1A (1)
- CD207 (1)
- CD22 (1)
- CD33 (1)
- CD3E (1)
Reactivities
- Human (389)
- Mouse (231)
- Rat (162)
- Bovine (13)
- Chicken (8)
- Canis (5)
- Dog (5)
- Monkey (5)
- Gorilla (3)
- Hamster (3)
- Horse (3)
- Pig (3)
- Primate (3)
- Rabbit (3)
- Chimpanzee (2)
- Bat (1)
- C. elegans (1)
- Gibbon (1)
- Guinea Pig (1)
- Macaque (1)
- Opossum (1)
- Orang-Utan (1)
- Porcine (1)
- Rhesus Monkey (1)
- Tobacco hornworm (1)
- Xenopus (1)
Applications
Clonalities
Conjugates
Modifications
Pathways
- Wnt signaling pathway (151)
- Pathways in cancer (142)
- Melanogenesis (103)
- Colorectal cancer (95)
- Toll-like receptor signaling pathway (93)
- Basal cell carcinoma (92)
- Hematopoietic cell lineage (91)
- Cytokine-cytokine receptor interaction (74)
- Focal adhesion (56)
- MAPK signaling pathway (54)
- NOD-like receptor signaling pathway (51)
- Fc epsilon RI signaling pathway (40)
- Regulation of actin cytoskeleton (40)
- Progesterone-mediated oocyte maturation (39)
- RIG-I-like receptor signaling pathway (37)
- T cell receptor signaling pathway (37)
- Adipocytokine signaling pathway (36)
- Cell adhesion molecules (CAMs) (34)
- Pathogenic Escherichia coli infection (34)
- Epithelial cell signaling in Helicobacter pylori infection (33)
- Type II diabetes mellitus (33)
- Neurotrophin signaling pathway (32)
- ErbB signaling pathway (31)
- GnRH signaling pathway (31)
- Jak-STAT signaling pathway (30)
- Leukocyte transendothelial migration (29)
- Pancreatic cancer (28)
- Insulin signaling pathway (27)
- Hedgehog signaling pathway (26)
- TGF-beta signaling pathway (26)
- Chemokine signaling pathway (24)
- Acute myeloid leukemia (22)
- Axon guidance (22)
- Primary immunodeficiency (21)
- Vascular smooth muscle contraction (20)
- Endocytosis (19)
- Alzheimer's disease (17)
- Amyotrophic lateral sclerosis (ALS) (17)
- Hypertrophic cardiomyopathy (HCM) (17)
- Apoptosis (16)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (16)
- Cytosolic DNA-sensing pathway (16)
- Graft-versus-host disease (15)
- Allograft rejection (14)
- B cell receptor signaling pathway (14)
- Dilated cardiomyopathy (13)
- Asthma (12)
- Cell cycle (12)
- Endometrial cancer (12)
- Oocyte meiosis (12)
- Renin-angiotensin system (12)
- Type I diabetes mellitus (12)
- Ubiquitin mediated proteolysis (12)
- Adherens junction (10)
- Antigen processing and presentation (10)
- Prion diseases (10)
- Prostate cancer (9)
- Systemic lupus erythematosus (9)
- Thyroid cancer (9)
- Natural killer cell mediated cytotoxicity (8)
- Notch signaling pathway (8)
- Autoimmune thyroid disease (7)
- ECM-receptor interaction (7)
- Complement and coagulation cascades (6)
- Fc gamma R-mediated phagocytosis (5)
- Glutathione metabolism (3)
- Metabolic pathways (3)
- Bladder cancer (2)
- Renal cell carcinoma (2)
- Small cell lung cancer (2)
- VEGF signaling pathway (2)
- Huntington's disease (1)
- Long-term depression (1)
- Lysosome (1)
- PPAR signaling pathway (1)
- Parkinson's disease (1)
- Viral myocarditis (1)