Germany
Japan
United Kingdom
China
Research Areas
View as table Download
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 428.00
In Stock
Goat Polyclonal Anti-CD45 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 1,260 aa to the C-terminus of human CD45 produced in E. coli. |
Goat Polyclonal Anti-CD19 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide within residues 510 aa to the C-terminus of human CD19 produced in E. coli. |
Rabbit polyclonal IL1R Antibody (C-term E487)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL1R antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 474-503 amino acids from the C-terminal region of human IL1R. |
Goat Anti-CD20 / MS4A1 (C Terminus) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CQDQESSPIENDSSP, from the C Terminus of the protein sequence according to NP_068769.2; NP_690605.1. |
Rabbit polyclonal antibody to CD74 (CD74 molecule, major histocompatibility complex, class II invariant chain)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 58 of CD74 (Uniprot ID#P04233) |
USD 515.00
In Stock
Rabbit Polyclonal ROCK1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ROCK1 |
Rabbit Polyclonal Anti-TCF7L2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TCF7L2 Antibody: synthetic peptide directed towards the N terminal of human TCF7L2. Synthetic peptide located within the following region: MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVN |
Rabbit polyclonal Neprilysin Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Neprilysin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 506-534 amino acids from the C-terminal region of human Neprilysin. |
Rabbit Polyclonal C/EBP- beta (Thr235/188) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human C/EBP- beta around the phosphorylation site of Threonine 235/188 |
| Modifications | Phospho-specific |
Goat Polyclonal Antibody against WNT4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SNWLYLAKLSSVGS, from the internal region of the protein sequence according to NP_110388.2. |
Rabbit polyclonal antibody to WNT10A (wingless-type MMTV integration site family, member 10A)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 47 and 271 of WNT10A (Uniprot ID#Q9GZT5) |
Rabbit polyclonal Estrogen Receptor-a (Ab-537) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Estrogen Receptor-a around the phosphorylation site of tyrosine 537 (P-L-YP-D-L). |
Rabbit polyclonal Estrogen Receptor-a (Tyr537) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ER-a around the phosphorylation site of tyrosine 537 (P-L-YP-D-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-ROR2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human ROR2. |
Rabbit polyclonal anti-FZD10 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FZD10. |
WNT2B Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | WNT2B antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT2B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Bat, Hamster, Panda, Horse, Rabbit, Pig (100%); Elephant (94%); Opossum, Platypus (88%). |
Rabbit Anti-Human TLR5 Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | TLR5 antibody was raised against synthetic peptide from human TLR5. |
Rabbit polyclonal CEBP Delta antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a recombinant protein corresponding to the amino terminus of mouse C/EBP. |
Rabbit Polyclonal CD19 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CD19 |
Active filters
Isotypes
- IgG
Availabilities
- In Stock
Filter by
Category
Target Symbol
- ESR1 (10)
- MAPK8 (6)
- CD19 (5)
- CD274 (5)
- CEBPD (4)
- FZD8 (4)
- KIT (4)
- LGALS3 (4)
- MME (4)
- PTPRC (4)
- CASP1 (3)
- FZD1 (3)
- FZD3 (3)
- FZD4 (3)
- IL1RN (3)
- IL2RA (3)
- ROCK1 (3)
- ROCK2 (3)
- TLR8 (3)
- AGBL2 (2)
- AGBL3 (2)
- ANAPC10 (2)
- ANAPC13 (2)
- ANAPC5 (2)
- ANPEP (2)
- CEBPB (2)
- CRP (2)
- ESR2 (2)
- FZD10 (2)
- FZD2 (2)
- ITGB3 (2)
- LRP5 (2)
- MAPK10 (2)
- ROR2 (2)
- TLR1 (2)
- TLR2 (2)
- TLR5 (2)
- TLR6 (2)
- TLR7 (2)
- TNF (2)
- TNFRSF8 (2)
- WNT10A (2)
- WNT2B (2)
- WNT4 (2)
- WNT5B (2)
- AGBL1 (1)
- AGBL5 (1)
- ANAPC2 (1)
- CD22 (1)
- CD33 (1)
- CD5 (1)
- CD68 (1)
- CD74 (1)
- CD8A (1)
- CEBPE (1)
- CR2 (1)
- CSRP1 (1)
- DVL2 (1)
- DVL3 (1)
- FCER2 (1)
- FCGR3A (1)
- FLJ22814 (1)
- FZD5 (1)
- FZD6 (1)
- FZD7 (1)
- FZD9 (1)
- HSF1 (1)
- IK (1)
- IL1B (1)
- IL1R1 (1)
- IL1R2 (1)
- IL1RL1 (1)
- IL36G (1)
- IL3RA (1)
- IL6ST (1)
- INTS1 (1)
- ITGA2B (1)
- ITGAX (1)
- LEF1 (1)
- LRP6 (1)
- MAP3K5 (1)
- MAP4K1 (1)
- MAPK9 (1)
- MS4A1 (1)
- NCAM1 (1)
- PDCD1 (1)
- PECAM1 (1)
- PTK7 (1)
- ROR1 (1)
- RORA (1)
- TCF4 (1)
- TCF7L2 (1)
- TLR3 (1)
- TLR4 (1)
- TMED1 (1)
- WNT1 (1)
- WNT11 (1)
- WNT2 (1)
- WNT3A (1)
- WNT6 (1)
Reactivities
Antibody Hosts
Clonalities
Conjugates
Modifications
Families
- Druggable Genome (155)
- Transmembrane (105)
- ES Cell Differentiation/IPS (39)
- Secreted Protein (32)
- Protein Kinase (25)
- Transcription Factors (25)
- GPCR (16)
- Nuclear Hormone Receptor (13)
- Adult stem cells (10)
- Protease (9)
- Stem cell - Pluripotency (6)
- Cancer stem cells (4)
- Embryonic stem cells (4)
- Phosphatase (4)
- Stem cell relevant signaling - Wnt Signaling pathway (4)
- Induced pluripotent stem cells (1)
Pathways
- Wnt signaling pathway (57)
- Pathways in cancer (53)
- Melanogenesis (43)
- Basal cell carcinoma (39)
- Colorectal cancer (34)
- Hematopoietic cell lineage (34)
- Toll-like receptor signaling pathway (27)
- Focal adhesion (18)
- Cytokine-cytokine receptor interaction (16)
- MAPK signaling pathway (16)
- Progesterone-mediated oocyte maturation (16)
- NOD-like receptor signaling pathway (15)
- Cell adhesion molecules (CAMs) (14)
- Hedgehog signaling pathway (14)
- Adipocytokine signaling pathway (11)
- Fc epsilon RI signaling pathway (11)
- RIG-I-like receptor signaling pathway (11)
- Type II diabetes mellitus (11)
- Neurotrophin signaling pathway (10)
- Primary immunodeficiency (10)
- Regulation of actin cytoskeleton (10)
- Epithelial cell signaling in Helicobacter pylori infection (9)
- ErbB signaling pathway (9)
- GnRH signaling pathway (9)
- Insulin signaling pathway (9)
- Pancreatic cancer (9)
- Pathogenic Escherichia coli infection (9)
- T cell receptor signaling pathway (9)
- TGF-beta signaling pathway (8)
- Alzheimer's disease (7)
- B cell receptor signaling pathway (7)
- Cell cycle (7)
- Endocytosis (7)
- Leukocyte transendothelial migration (7)
- Oocyte meiosis (7)
- Ubiquitin mediated proteolysis (7)
- Acute myeloid leukemia (6)
- Amyotrophic lateral sclerosis (ALS) (6)
- Axon guidance (6)
- Chemokine signaling pathway (6)
- Renin-angiotensin system (6)
- Vascular smooth muscle contraction (6)
- Apoptosis (5)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (5)
- Dilated cardiomyopathy (5)
- Fc gamma R-mediated phagocytosis (5)
- Hypertrophic cardiomyopathy (HCM) (5)
- Jak-STAT signaling pathway (5)
- Cytosolic DNA-sensing pathway (4)
- ECM-receptor interaction (3)
- Graft-versus-host disease (3)
- Natural killer cell mediated cytotoxicity (3)
- Systemic lupus erythematosus (3)
- Type I diabetes mellitus (3)
- Adherens junction (2)
- Allograft rejection (2)
- Antigen processing and presentation (2)
- Asthma (2)
- Endometrial cancer (2)
- Glutathione metabolism (2)
- Metabolic pathways (2)
- Notch signaling pathway (2)
- Prion diseases (2)
- Prostate cancer (2)
- Thyroid cancer (2)
- Complement and coagulation cascades (1)
- Lysosome (1)
- Small cell lung cancer (1)