Rabbit Polyclonal Anti-LEF1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human LEF1 |
Rabbit Polyclonal Anti-LEF1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human LEF1 |
c Kit (KIT) mouse monoclonal antibody, clone B-K15, PE
Applications | FC |
Reactivities | Human |
Conjugation | PE |
c Kit (KIT) mouse monoclonal antibody, clone B-K15, Azide Free
Applications | FC, FN |
Reactivities | Human |
c Kit (KIT) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide surrounding amino acids 901-950 Glu930 of Human c-Kit. |
Rabbit Polyclonal KIT (Tyr703) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human KIT around the phosphorylation site of Tyrosine 703 |
Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-c-Kit (Tyr721) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human c-Kit around the phosphorylation site of Tyrosine 721. |
Modifications | Phospho-specific |
Rabbit Polyclonal KIT Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human KIT. |
Rabbit Polyclonal Anti-LEF1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LEF1 antibody: synthetic peptide directed towards the C terminal of human LEF1. Synthetic peptide located within the following region: VKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQ |
c Kit (KIT) rabbit polyclonal antibody, Aff - Purified
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Mouse monoclonal KIT Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal LEF1 Antibody (N-term)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This LEF1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 10-37 amino acids from the N-terminal region of human LEF1. |
Rabbit Polyclonal c-Kit Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human c-Kit |
c Kit (KIT) mouse monoclonal antibody, clone B-K15, Biotin
Applications | FC |
Reactivities | Human |
Conjugation | Biotin |
c Kit (KIT) mouse monoclonal antibody, clone B-K15, Purified
Applications | FC |
Reactivities | Human |
c Kit (KIT) rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human |
Immunogen | peptide sequence around amino acids 934~938 (H-I-Y-S-N) derived from Human c-kit. |
c Kit (KIT) rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human |
Immunogen | peptide sequence around amino acids 934~938 (H-I-Y-S-N) derived from Human c-kit. |
c Kit (KIT) pTyr721 rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Goat Polyclonal Antibody against LEF1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QHEQRKEQEPKRPH, from the internal region of the protein sequence according to NP_057353.1. |
Goat Polyclonal KIT/CD117 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence KRDSFICSKQEDH, from the internal region of the protein sequence according to NP_000213.1; NP_001087241.1 |
Rabbit Polyclonal Anti-LEF1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LEF1 antibody: synthetic peptide directed towards the N terminal of human LEF1. Synthetic peptide located within the following region: VARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMN |
Rabbit Polyclonal Anti-LEF1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LEF1 antibody: synthetic peptide directed towards the middle region of human LEF1. Synthetic peptide located within the following region: ADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGG |
Rabbit anti CD117 (kit) Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Rokhlin OW, et al. a prostate-specific surface-reactive monoclonal antibody. Cancer Lett. 131: 129-136, 1998. |
Rabbit anti CD117/Kit (NT)/c-Kit Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide derived from N-terminus of human Kit protein. This sequence is identical among human and dog origins. |
Rabbit anti CD117/Kit (IN)/c-Kit Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide derived from extracellular domain of Kit protein. This sequence is identical in human and dog origins. |
KIT Capture mouse monoclonal antibody, Luminex validated, clone OTI1E2
Applications | LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KIT mouse monoclonal antibody, clone OTI2E3 (formerly 2E3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KIT mouse monoclonal antibody, clone OTI1E2 (formerly 1E2)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KIT (c-Kit ) mouse monoclonal antibody, clone OTI2C1D5
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KIT mouse monoclonal antibody, clone OTI3F9 (formerly 3F9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KIT mouse monoclonal antibody, clone OTI2B5 (formerly 2B5)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KIT mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KIT mouse monoclonal antibody, clone OTI9A11 (formerly 9A11)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KIT mouse monoclonal antibody, clone OTI2C1H4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KIT mouse monoclonal antibody, clone OTI1B6 (formerly 1B6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KIT mouse monoclonal antibody, clone OTI2B12 (formerly 2B12)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KIT mouse monoclonal antibody, clone OTI6F8 (formerly 6F8)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KIT mouse monoclonal antibody,clone OTI14B1
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LEF1 mouse monoclonal antibody,clone OTI10A7
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-KIT Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KIT |
USD 379.00
In Stock
PIK3CG mouse monoclonal antibody,clone OTI4G10
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 399.00
2 Weeks
KIT biotinylated detection antibody, Luminex validated mouse monoclonal antibody, clone OTI3F9
Applications | LMNX |
Reactivities | Human |
Conjugation | Biotin |
Matched ELISA Pair | TA600050 |
KIT (c-Kit ) mouse monoclonal antibody, clone OTI2E3 (formerly 2E3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
5 Days
KIT mouse monoclonal antibody,clone 2E3, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
5 Days
KIT mouse monoclonal antibody,clone 2E3, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
KIT (c-Kit ) mouse monoclonal antibody, clone OTI2E3 (formerly 2E3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
KIT (c-Kit ) mouse monoclonal antibody, clone OTI1E2 (formerly 1E2)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
5 Days
KIT mouse monoclonal antibody,clone 1E2, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
5 Days
KIT mouse monoclonal antibody,clone 1E2, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
KIT (c-Kit ) mouse monoclonal antibody, clone OTI1E2 (formerly 1E2)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
KIT (c-Kit ) mouse monoclonal antibody, clone OTI2C1D5
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |