Research Areas

cDNA Clones (32)
Proteins (21)
Antibodies (5)
Jump to Filters
View as table Download
Apc10 (ANAPC10) (NM_014885) Human Tagged ORF Clone
RC202679

USD 98.00

USD 390.00

In Stock

ANAPC10 (Myc-DDK-tagged)-Human anaphase promoting complex subunit 10 (ANAPC10)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Apc10 (ANAPC10) (NM_014885) Human Tagged ORF Clone
RG202679

USD 460.00

In Stock

ANAPC10 (GFP-tagged) - Human anaphase promoting complex subunit 10 (ANAPC10)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Apc10 (ANAPC10) (NM_014885) Human Tagged ORF Clone
RC202679L3

USD 620.00

3 Weeks

Lenti ORF clone of Human anaphase promoting complex subunit 10 (ANAPC10), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Apc10 (ANAPC10) (NM_014885) Human Tagged ORF Clone Lentiviral Particle
RC202679L3V

USD 820.00

5 Weeks

Lenti ORF particles, ANAPC10 (Myc-DDK tagged) - Human anaphase promoting complex subunit 10 (ANAPC10), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Apc10 (ANAPC10) (NM_014885) Human Tagged ORF Clone
RC202679L4

USD 620.00

3 Weeks

Lenti ORF clone of Human anaphase promoting complex subunit 10 (ANAPC10), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Apc10 (ANAPC10) (NM_001256710) Human Tagged ORF Clone
RC231686

USD 420.00

3 Weeks

ANAPC10 (Myc-DDK tagged) - Homo sapiens anaphase promoting complex subunit 10 (ANAPC10), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Apc10 (ANAPC10) (NM_001256706) Human Tagged ORF Clone
RC232012

USD 420.00

3 Weeks

ANAPC10 (Myc-DDK tagged) - Homo sapiens anaphase promoting complex subunit 10 (ANAPC10), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Apc10 (ANAPC10) (NM_001256707) Human Tagged ORF Clone
RC232013

USD 420.00

3 Weeks

ANAPC10 (Myc-DDK tagged) - Homo sapiens anaphase promoting complex subunit 10 (ANAPC10), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Apc10 (ANAPC10) (NM_001256708) Human Tagged ORF Clone
RC232014

USD 420.00

3 Weeks

ANAPC10 (Myc-DDK tagged) - Homo sapiens anaphase promoting complex subunit 10 (ANAPC10), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Apc10 (ANAPC10) (NM_001256709) Human Tagged ORF Clone
RC232082

USD 420.00

3 Weeks

ANAPC10 (Myc-DDK tagged) - Homo sapiens anaphase promoting complex subunit 10 (ANAPC10), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Apc10 (ANAPC10) (NM_001256712) Human Tagged ORF Clone
RC235515

USD 420.00

2 Weeks

ANAPC10 (myc-DDK-tagged) - Human anaphase promoting complex subunit 10 (ANAPC10), transcript variant 8

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Apc10 (ANAPC10) (NM_001256711) Human Tagged ORF Clone
RC235707

USD 420.00

2 Weeks

ANAPC10 (myc-DDK-tagged) - Human anaphase promoting complex subunit 10 (ANAPC10), transcript variant 7

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Apc10 (ANAPC10) (NM_001256710) Human Tagged ORF Clone
RG231686

USD 460.00

3 Weeks

ANAPC10 (GFP-tagged) - Homo sapiens anaphase promoting complex subunit 10 (ANAPC10), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Apc10 (ANAPC10) (NM_001256706) Human Tagged ORF Clone
RG232012

USD 460.00

3 Weeks

ANAPC10 (GFP-tagged) - Homo sapiens anaphase promoting complex subunit 10 (ANAPC10), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Apc10 (ANAPC10) (NM_001256707) Human Tagged ORF Clone
RG232013

USD 460.00

3 Weeks

ANAPC10 (GFP-tagged) - Homo sapiens anaphase promoting complex subunit 10 (ANAPC10), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Apc10 (ANAPC10) (NM_001256708) Human Tagged ORF Clone
RG232014

USD 460.00

3 Weeks

ANAPC10 (GFP-tagged) - Homo sapiens anaphase promoting complex subunit 10 (ANAPC10), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Apc10 (ANAPC10) (NM_001256709) Human Tagged ORF Clone
RG232082

USD 460.00

3 Weeks

ANAPC10 (GFP-tagged) - Homo sapiens anaphase promoting complex subunit 10 (ANAPC10), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Apc10 (ANAPC10) Rabbit Polyclonal Antibody
TA319413

USD 530.00

5 Days

Rabbit polyclonal anti-APC10 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids near the amino terminus of human APC10.
Apc10 (ANAPC10) (NM_014885) Human Tagged ORF Clone
RC202679L1

USD 620.00

In Stock

Lenti ORF clone of Human anaphase promoting complex subunit 10 (ANAPC10), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Apc10 (ANAPC10) (NM_014885) Human Over-expression Lysate
LY414956

USD 396.00

In Stock

Transient overexpression lysate of anaphase promoting complex subunit 10 (ANAPC10)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Apc10 (ANAPC10) (NM_014885) Human Tagged ORF Clone
RC202679L2

USD 620.00

3 Weeks

Lenti ORF clone of Human anaphase promoting complex subunit 10 (ANAPC10), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Apc10 (ANAPC10) (NM_014885) Human Untagged Clone
SC126079

USD 310.00

In Stock

ANAPC10 (untagged)-Human anaphase promoting complex subunit 10 (ANAPC10)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Apc10 (ANAPC10) Rabbit Polyclonal Antibody
TA319814

USD 430.00

5 Days

Rabbit Polyclonal APC10 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen APC10 antibody was raised against a 16 amino acid synthetic peptide near the center of human APC10.
Apc10 (ANAPC10) (NM_014885) Human Over-expression Lysate
LC414956

USD 121.00

In Stock

ANAPC10 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Apc10 (ANAPC10) Rabbit Polyclonal Antibody
TA329846

USD 375.00

5 Days

Rabbit Polyclonal Anti-ANAPC10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ANAPC10 antibody: synthetic peptide directed towards the N terminal of human ANAPC10. Synthetic peptide located within the following region: MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNL
Apc10 (ANAPC10) (NM_014885) Human Mass Spec Standard
PH302679

USD 2,055.00

3 Weeks

ANAPC10 MS Standard C13 and N15-labeled recombinant protein (NP_055700)

Tag C-Myc/DDK
Expression Host HEK293
Apc10 (ANAPC10) (NM_001256712) Human Tagged ORF Clone
RG235515

USD 460.00

2 Weeks

ANAPC10 (GFP-tagged) - Human anaphase promoting complex subunit 10 (ANAPC10), transcript variant 8

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Apc10 (ANAPC10) (NM_001256711) Human Tagged ORF Clone
RG235707

USD 460.00

2 Weeks

ANAPC10 (GFP-tagged) - Human anaphase promoting complex subunit 10 (ANAPC10), transcript variant 7

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Apc10 (ANAPC10) (NM_001256706) Human Untagged Clone
SC330502

USD 310.00

3 Weeks

ANAPC10 (untagged) - Homo sapiens anaphase promoting complex subunit 10 (ANAPC10), transcript variant 1

Vector pCMV6 series
Tag Tag Free
Apc10 (ANAPC10) (NM_001256707) Human Untagged Clone
SC330503

USD 310.00

3 Weeks

ANAPC10 (untagged) - Homo sapiens anaphase promoting complex subunit 10 (ANAPC10), transcript variant 3

Vector pCMV6 series
Tag Tag Free
Apc10 (ANAPC10) (NM_001256708) Human Untagged Clone
SC330504

USD 310.00

3 Weeks

ANAPC10 (untagged) - Homo sapiens anaphase promoting complex subunit 10 (ANAPC10), transcript variant 4

Vector pCMV6 series
Tag Tag Free
Apc10 (ANAPC10) (NM_001256709) Human Untagged Clone
SC330505

USD 310.00

3 Weeks

ANAPC10 (untagged) - Homo sapiens anaphase promoting complex subunit 10 (ANAPC10), transcript variant 5

Vector pCMV6 series
Tag Tag Free
Apc10 (ANAPC10) (NM_001256710) Human Untagged Clone
SC330506

USD 310.00

3 Weeks

ANAPC10 (untagged) - Homo sapiens anaphase promoting complex subunit 10 (ANAPC10), transcript variant 6

Vector pCMV6 series
Tag Tag Free
Apc10 (ANAPC10) (NM_001256712) Human Untagged Clone
SC333409

USD 310.00

2 Weeks

ANAPC10 (untagged) - Human anaphase promoting complex subunit 10 (ANAPC10), transcript variant 8

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Apc10 (ANAPC10) (NM_001256711) Human Untagged Clone
SC333601

USD 310.00

2 Weeks

ANAPC10 (untagged) - Human anaphase promoting complex subunit 10 (ANAPC10), transcript variant 7

Vector pCMV6 series
Tag Tag Free
Apc10 (ANAPC10) Rabbit Polyclonal Antibody
TA324229

USD 345.00

In Stock

Anti-ANAPC10 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
Apc10 (ANAPC10) Rabbit Polyclonal Antibody
TA324230

USD 345.00

In Stock

Anti-ANAPC10 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
Apc10 (ANAPC10) (NM_014885) ICC Control Block
TB402679

USD 1,040.00

4 Weeks

Transient overexpression of ANAPC10 (NM_014885) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Apc10 (ANAPC10) (NM_001256710) ICC Control Block
TB431686

USD 1,070.00

4 Weeks

Transient overexpression of ANAPC10 (NM_001256710) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Apc10 (ANAPC10) (NM_001256706) ICC Control Block
TB432012

USD 1,070.00

4 Weeks

Transient overexpression of ANAPC10 (NM_001256706) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Apc10 (ANAPC10) (NM_001256707) ICC Control Block
TB432013

USD 1,070.00

4 Weeks

Transient overexpression of ANAPC10 (NM_001256707) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Apc10 (ANAPC10) (NM_001256708) ICC Control Block
TB432014

USD 1,070.00

4 Weeks

Transient overexpression of ANAPC10 (NM_001256708) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Apc10 (ANAPC10) (NM_001256709) ICC Control Block
TB432082

USD 1,070.00

4 Weeks

Transient overexpression of ANAPC10 (NM_001256709) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Apc10 (ANAPC10) (NM_001256712) ICC Control Block
TB435515

USD 1,070.00

4 Weeks

Transient overexpression of ANAPC10 (NM_001256712) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Apc10 (ANAPC10) (NM_001256711) ICC Control Block
TB435707

USD 1,070.00

4 Weeks

Transient overexpression of ANAPC10 (NM_001256711) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Apc10 (ANAPC10) Cytosection
TS402679

USD 225.00

4 Weeks

Transient overexpression of ANAPC10 (NM_014885) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack