Products

View as table Download

Rabbit monoclonal antibody against Phospho-c-Myc (pT58/S62)(E203) (phospho-specific)

Applications FC, IF, WB
Reactivities Human, Rat
Conjugation Unconjugated
Modifications Phospho-specific

Anti-Human EGF Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived recombinant Human EGF

Rabbit Polyclonal MYC Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human MYC

Rabbit Polyclonal antibody to c-Myc (v-myc myelocytomatosis viral oncogene homolog (avian))

Applications Assay, FC, IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 52 of c-Myc (Uniprot ID#P01106)

Rabbit Polyclonal Anti-EGF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EGF antibody: synthetic peptide directed towards the middle region of human EGF. Synthetic peptide located within the following region: ITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDY

EGF rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) E.coli derived recombinant Human EGF (hEGF).

EGF rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) E.coli derived recombinant Human EGF (hEGF).

c-Myc (MYC) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Immunogen This antibody was purified from whole rabbit serum prepared by repeated immunizations with Myc epitope tag peptide E-Q-K-L-I-S-E-E-D-L conjugated to KLH using maleimide.

Rabbit polyclonal MYC antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human Myc.

Rabbit Polyclonal c-Myc Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to the human c-Myc protein (between residues 400-450) [UniProt P01106]

Rabbit Polyclonal Anti-MYC Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-MYC Antibody: A synthesized peptide derived from human MYC

Rabbit Polyclonal Anti-EGF Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-EGF Antibody: A synthesized peptide derived from human EGF

EGF rabbit polyclonal antibody, Serum

Applications ELISA, IHC, WB
Immunogen Recombinant EGF precursor from Suberites domuncula.

EGF rabbit polyclonal antibody, Serum

Applications ELISA, IHC, WB
Immunogen Recombinant EGF precursor from Suberites domuncula.

c-Myc (MYC) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

EGF rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

EGF rabbit polyclonal antibody, Biotin

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (>98%) recombinant hEGF (human EGF).

EGF rabbit polyclonal antibody, Biotin

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (>98%) recombinant hEGF (human EGF).

c-Myc (MYC) rabbit polyclonal antibody, Biotin

Applications ELISA, IHC, WB
Conjugation Biotin
Immunogen Purified from whole rabbit serum prepared by repeated immunizations with Myc epitope tag peptide E-Q-K-L-I-S-E-E-D-L conjugated to KLH using maleimide. The sequence corresponds to aa 410-419 of human c-Myc.

c-Myc (MYC) rabbit polyclonal antibody, HRP

Applications ELISA, IHC, WB
Conjugation HRP
Immunogen Purified from whole rabbit serum prepared by repeated immunizations with Myc epitope tag peptide E-Q-K-L-I-S-E-E-D-L conjugated to KLH using maleimide. The sequence corresponds to aa 410-419 of human c-Myc.

Rabbit Polyclonal C-myc antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human C-myc

Rabbit Polyclonal Myc (Thr58) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Myc around the phosphorylation site of Threonine 58
Modifications Phospho-specific

Biotinylated Anti-Human EGF Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived recombinant Human EGF

EGF (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 689-720 amino acids from the Central region of human EGF

c-Myc (MYC) rabbit polyclonal antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Antibody against MYC (T58)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This MYC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 36-65 amino acids from human MYC.

Rabbit Polyclonal Antibody against MYC (S62)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This MYC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 40-69 amino acids from human MYC.

Rabbit Polyclonal Antibody against MYC (S373)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This MYC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 351-380 amino acids from human MYC.

Rabbit Polyclonal MYC Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human MYC

Rabbit Polyclonal Myc (Ser62) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Myc around the phosphorylation site of Serine 62
Modifications Phospho-specific

Rabbit anti Myc-Tag Polyclonal Antibody

Applications WB
Conjugation Unconjugated
Immunogen A synthetic peptide of EQKLISEEDL conjugated to a carrier protein.
EGF

USD 700.00

2 Weeks

Rabbit Polyclonal Anti-EGF Antibody, Purified

Applications E(capture)
Reactivities Human
Immunogen Purified recombinant human EGF

c-Myc (MYC) pSer62 rabbit polyclonal antibody, Aff - Purified

Applications IF
Reactivities Human, Mouse, Rat
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Myc around the phosphorylation site of Serine 62(P-L-Sp-P-S).

c-Myc (MYC) pSer62 rabbit polyclonal antibody, Aff - Purified

Applications IF
Reactivities Human, Mouse, Rat
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Myc around the phosphorylation site of Serine 62(P-L-Sp-P-S).

Rabbit anti c-Myc Polyclonal Antibody

Conjugation Unconjugated

Rabbit anti Myc(pT358) Polyclonal Antibody

Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit anti Myc(pT58) Polyclonal Antibody

Reactivities Human, Mouse
Conjugation Unconjugated

Anti-EGF Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 926-1026 amino acids of human epidermal growth factor

Anti-EGF Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 926-1026 amino acids of human epidermal growth factor