Germany
Japan
United Kingdom
China
Products
View as table Download
Rabbit Polyclonal Anti-SMURF2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | SMURF2 antibody was raised against a 17 amino acid peptide near the amino terminus of human SMURF2. The immunogen is located within amino acids 140 - 190 of SMURF2. |
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Rabbit Polyclonal Smad2/3 (Thr8) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Smad2/3 around the phosphorylation site of Threonine 8 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-FZD7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD7 antibody: synthetic peptide directed towards the C terminal of human FZD7. Synthetic peptide located within the following region: PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV |
Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185 |
| Modifications | Phospho-specific |
Anti-RHOA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 179-189 amino acids of Human ras homolog family member A |
Cyclin D1 (CCND1) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to amino acids 55-100 of Human Cyclin D1. |
Rabbit Polyclonal antibody to CaMKII delta (calcium/calmodulin-dependent protein kinase II delta)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 249 and 445 of CaMK2D (Uniprot ID#Q13557) |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit Polyclonal Anti-WNT2B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide directed towards the middle region of human WNT2B. Synthetic peptide located within the following region: LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT |
Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA |
Rabbit polyclonal CaMKII (Thr305) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CaMKII around the phosphorylation site of threonine 305 (I-L-TP-T-M). |
| Modifications | Phospho-specific |
Anti-RAC2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 50-192 amino acids of human ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) |
Rabbit Polyclonal Anti-FZD9 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD9 antibody: synthetic peptide directed towards the N terminal of human FZD9. Synthetic peptide located within the following region: RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF |
Rabbit Polyclonal Anti-WNT3A Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT3A antibody: synthetic peptide directed towards the N terminal of human WNT3A. Synthetic peptide located within the following region: MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP |
Rabbit Polyclonal Anti-TCF7L1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCF7L1 antibody: synthetic peptide directed towards the N terminal of human TCF7L1. Synthetic peptide located within the following region: ESENQSSSSDSEAERRPQPVRDTFQKPRDYFAEVRRPQDSAFFKGPPYPG |
Rabbit Polyclonal p53 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-p53 antibody: human p53 (tumor protein p53), using a KLH-conjugated synthetic peptide containing a sequence from the C-terminal part of the protein. |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-WNT2B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide directed towards the middle region of human WNT2B. Synthetic peptide located within the following region: LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT |
Rabbit Polyclonal Antibody against RAC1 (S71)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RAC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 49-78 amino acids from human RAC1. |
Rabbit polyclonal SMAD3-S208 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SMAD3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from human SMAD3. |
Rabbit Polyclonal ROCK1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ROCK1 |
Active filters
Antibody Hosts
- Rabbit
Pathways
- Wnt signaling pathway
Filter by
Category
Target Symbol
- TP53 (49)
- CTNNB1 (33)
- JUN (27)
- MYC (24)
- MAPK8 (21)
- SMAD2 (21)
- SMAD3 (21)
- GSK3B (18)
- PRKCA (16)
- ROCK2 (15)
- CCND1 (14)
- CTBP1 (14)
- MAP3K7 (11)
- PRKCB (11)
- CSNK2A1 (10)
- NFATC1 (10)
- CAMK2A (9)
- CTBP2 (9)
- EP300 (9)
- NFATC4 (9)
- PPARD (9)
- WNT1 (9)
- APC (8)
- DKK1 (8)
- PRKACA (8)
- SMAD4 (8)
- TCF7 (8)
- WNT5B (8)
- CAMK2B (7)
- CCND3 (7)
- CREBBP (7)
- CUL1 (7)
- MMP7 (7)
- PPP3CA (7)
- PSEN1 (7)
- RHOA (7)
- WNT2B (7)
- CCND2 (6)
- CSNK1A1 (6)
- FZD2 (6)
- FZD4 (6)
- FZD9 (6)
- NFATC2 (6)
- PPP2CA (6)
- PRKCG (6)
- ROCK1 (6)
- SIAH1 (6)
- WNT10A (6)
- WNT10B (6)
- WNT3A (6)
- WNT4 (6)
- WNT6 (6)
- WNT8B (6)
- WNT9A (6)
- CAMK2G (5)
- DVL2 (5)
- FZD1 (5)
- FZD10 (5)
- FZD8 (5)
- LEF1 (5)
- LRP5 (5)
- MAPK9 (5)
- NFATC3 (5)
- PPP2R1A (5)
- RAC1 (5)
- SENP2 (5)
- SFRP1 (5)
- SKP1 (5)
- WNT16 (5)
- WNT2 (5)
- WNT8A (5)
- AXIN1 (4)
- AXIN2 (4)
- CSNK1E (4)
- CSNK2B (4)
- DKK2 (4)
- FBXW11 (4)
- FOSL1 (4)
- FZD3 (4)
- FZD5 (4)
- FZD6 (4)
- LRP6 (4)
- MAPK10 (4)
- PLCB3 (4)
- PPP3CB (4)
- PRKACB (4)
- SOX17 (4)
- TBL1XR1 (4)
- TCF7L2 (4)
- TTK (4)
- VANGL1 (4)
- WIF1 (4)
- WNT9B (4)
- APC2 (3)
- CAMK2D (3)
- CHP1 (3)
- CSNK2A2 (3)
- CXXC4 (3)
- DKK4 (3)
- DVL1 (3)
Reactivities
- Human (690)
- Mouse (489)
- Rat (398)
- Bovine (49)
- Chicken (25)
- Pig (24)
- Monkey (23)
- Rabbit (19)
- Dog (16)
- Hamster (13)
- Xenopus (13)
- Gorilla (12)
- Bat (11)
- Horse (11)
- Gibbon (10)
- Zebrafish (10)
- Canis (6)
- Primate (4)
- Rhesus Monkey (4)
- X. tropicalis (4)
- C. elegans (2)
- Canine (2)
- Chimpanzee (2)
- Drosophila (2)
- Guinea Pig (2)
- Opossum (2)
- Sheep (2)
- Feline (1)
- Macaque (1)
- Orang-Utan (1)
- Tobacco hornworm (1)
Applications
Clonalities
Conjugates
Modifications
Families
- Druggable Genome (748)
- Transcription Factors (293)
- ES Cell Differentiation/IPS (262)
- Protein Kinase (187)
- Secreted Protein (124)
- Transmembrane (121)
- Stem cell relevant signaling - Wnt Signaling pathway (117)
- Cancer stem cells (108)
- Stem cell - Pluripotency (98)
- Stem cell relevant signaling - JAK/STAT signaling pathway (80)
- Embryonic stem cells (66)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (66)
- Adult stem cells (59)
- Phosphatase (43)
- GPCR (40)
- Induced pluripotent stem cells (39)
- Protease (19)
- Stem cell relevant signaling - DSL/Notch pathway (14)
- Nuclear Hormone Receptor (9)