Products

View as table Download

Rabbit anti-NR1I3 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human NR1I3

Rabbit polyclonal anti-NR1I3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NR1I3.

Constitutive androstane receptor (NR1I3) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human

Rabbit Polyclonal Anti-NR1I3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR1I3 antibody: synthetic peptide directed towards the N terminal of human NR1I3. Synthetic peptide located within the following region: MASREDELRNCVVCGDQATGYHFNALTCEGCKGFFRRTVSKSIGPTCPFA

Rabbit Polyclonal Anti-NR1I3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR1I3 antibody: synthetic peptide directed towards the middle region of human NR1I3. Synthetic peptide located within the following region: PVFRSLPIEDQISLLKGAAVEICHIVLNTTFCLQTQNFLCGPLRYTIEDG

Rabbit Polyclonal Anti-NR1I3 Antibody

Applications IHC, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NR1I3 antibody: synthetic peptide directed towards the C terminal of mouse NR1I3. Synthetic peptide located within the following region: QQSRLQSRFLYAKLMGLLADLRSINNAYSYELQRLEELSAMTPLLGEICS

Rabbit Polyclonal Anti-NR1I3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR1I3 antibody: synthetic peptide directed towards the C terminal of human NR1I3. Synthetic peptide located within the following region: FHGTLRKLQLQEPEYVLLAAMALFSPDRPGVTQRDEIDQLQEEMALTLQS

Carrier-free (BSA/glycerol-free) NR1I3 mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NR1I3 mouse monoclonal antibody, clone OTI10F9 (formerly 10F9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NR1I3 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

NR1I3 Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse NR1I3

NR1I3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human NR1I3

NR1I3 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human NR1I3.

NR1I3 mouse monoclonal antibody, clone OTI2H10 (formerly 2H10), Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin

NR1I3 mouse monoclonal antibody, clone OTI10F9 (formerly 10F9), Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin

NR1I3 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6), Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin

NR1I3 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6), HRP conjugated

Applications IHC, WB
Reactivities Human
Conjugation HRP