Products

View as table Download

LYZ rabbit polyclonal antibody, Azide Free

Applications ELISA, IF, IHC, WB
Reactivities Human
Immunogen Highly purified lysozyme is isolated from pooled milk. Freund's complete adjuvant is used in the first step of the immunization procedure.

LYZ rabbit polyclonal antibody, Biotin

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly purified lysozyme is isolated from pooled milk.
Freund's complete adjuvant is used in the first step of the immunization procedure.

LYZ rabbit polyclonal antibody, HRP

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation HRP
Immunogen Highly purified lysozyme is isolated from pooled milk. Freund's complete adjuvant is used in the first step of the immunization procedure.

LYZ rabbit polyclonal antibody, FITC

Applications ELISA, IF, IHC
Reactivities Human
Conjugation FITC
Immunogen Highly purified lysozyme is isolated from pooled milk. Freund's complete adjuvant is used in the first step of the immunization procedure.

Lysozyme (LYZ) sheep polyclonal antibody, Aff - Purified

Applications ELISA
Reactivities Human
Immunogen Human Lysozyme.

Lysozyme (LYZ) sheep polyclonal antibody, Aff - Purified

Applications ELISA
Immunogen Human Lysozyme.

Lysozyme (LYZ) rabbit polyclonal antibody, Purified

Applications IHC
Reactivities Canine, Feline, Human, Monkey, Porcine
Immunogen Human Lysozyme purified from the urine of patients with monocytic leukemia.

LYZ rabbit polyclonal antibody, Serum

Applications IP
Reactivities Human
Immunogen Highly purified lysozyme is isolated from pooled milk. Freund’s complete adjuvant is used in the first step of the immunization procedure.

Rabbit Polyclonal Lysozyme Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-LYZ Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LYZ antibody: synthetic peptide directed towards the C terminal of human LYZ. Synthetic peptide located within the following region: HLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQYVQG

Rabbit Polyclonal Anti-LYZ Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LYZ antibody: synthetic peptide directed towards the N terminal of human LYZ. Synthetic peptide located within the following region: CLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHL

Rabbit anti Lysozyme Polyclonal Antibody

Applications WB
Reactivities Human
Immunogen A synthetic peptide corresponding to the C-terminus 115-129aa of chicken egg white Lysozyme protein.

Carrier-free (BSA/glycerol-free) LYZ mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LYZ mouse monoclonal antibody, clone OTI1D8 (formerly 1D8)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LYZ mouse monoclonal antibody, clone OTI2C2 (formerly 2C2)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Anti-LYZ Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 19-148 amino acids of human lysozymelysozyme

Anti-LYZ Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 19-148 amino acids of human lysozymelysozyme

Lysozyme (LYZ) Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Lysozyme (Lysozyme (LYZ)) (NP_000230.1).
Modifications Unmodified

Lysozyme (LYZ) Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 19-148 of human Lysozyme (Lysozyme (LYZ)) (NP_000230.1).
Modifications Unmodified

Lysozyme Rabbit polyclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human Lysozyme

Lysozyme Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide of human Lysozyme

LYZ mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

LYZ mouse monoclonal antibody, clone OTI1D8 (formerly 1D8)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

LYZ mouse monoclonal antibody, clone OTI2C2 (formerly 2C2)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated