Products

View as table Download

Recombinant protein of human lysozyme (renal amyloidosis) (LYZ)

Tag C-Myc/DDK
Expression Host HEK293T

LYZ (GFP-tagged) - Human lysozyme (LYZ)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lyz1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN509616 is the updated version of KN309616.

LYZ (untagged)-Human lysozyme (LYZ)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

LYZ rabbit polyclonal antibody, Azide Free

Applications ELISA, IF, IHC, WB
Reactivities Human
Immunogen Highly purified lysozyme is isolated from pooled milk. Freund's complete adjuvant is used in the first step of the immunization procedure.

USD 610.00

5 Days

Lysozyme C human protein, 1 mg

Protein Source Neutrophils

LYZ rabbit polyclonal antibody, Biotin

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly purified lysozyme is isolated from pooled milk.
Freund's complete adjuvant is used in the first step of the immunization procedure.

LYZ rabbit polyclonal antibody, HRP

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation HRP
Immunogen Highly purified lysozyme is isolated from pooled milk. Freund's complete adjuvant is used in the first step of the immunization procedure.

LYZ rabbit polyclonal antibody, FITC

Applications ELISA, IF, IHC
Reactivities Human
Conjugation FITC
Immunogen Highly purified lysozyme is isolated from pooled milk. Freund's complete adjuvant is used in the first step of the immunization procedure.

LYZ HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

Lenti ORF clone of Human lysozyme (LYZ), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Lysozyme (LYZ) sheep polyclonal antibody, Aff - Purified

Applications ELISA
Reactivities Human
Immunogen Human Lysozyme.

Lysozyme (LYZ) sheep polyclonal antibody, Aff - Purified

Applications ELISA
Immunogen Human Lysozyme.

Lysozyme (LYZ) rabbit polyclonal antibody, Purified

Applications IHC
Reactivities Canine, Feline, Human, Monkey, Porcine
Immunogen Human Lysozyme purified from the urine of patients with monocytic leukemia.

LYZ rabbit polyclonal antibody, Serum

Applications IP
Reactivities Human
Immunogen Highly purified lysozyme is isolated from pooled milk. Freund’s complete adjuvant is used in the first step of the immunization procedure.

Rabbit Polyclonal Lysozyme Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-LYZ Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LYZ antibody: synthetic peptide directed towards the C terminal of human LYZ. Synthetic peptide located within the following region: HLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQYVQG

Rabbit Polyclonal Anti-LYZ Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LYZ antibody: synthetic peptide directed towards the N terminal of human LYZ. Synthetic peptide located within the following region: CLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHL

Rabbit anti Lysozyme Polyclonal Antibody

Applications WB
Reactivities Human
Immunogen A synthetic peptide corresponding to the C-terminus 115-129aa of chicken egg white Lysozyme protein.

Carrier-free (BSA/glycerol-free) LYZ mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LYZ mouse monoclonal antibody, clone OTI1D8 (formerly 1D8)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LYZ mouse monoclonal antibody, clone OTI2C2 (formerly 2C2)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

USD 445.00

3 Weeks

Human Lysozyme ELISA kit

Assay Type Solid Phase Sandwich ELISA
Format 8x12 divisible strips
Reactivities Human

LYZ CRISPRa kit - CRISPR gene activation of human lysozyme

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

qPCR primer pairs and template standards against Homo sapiens gene LYZ

Application Plasmid of exact quantity for transcript copy number calculation

qSTAR qPCR primer pairs against Homo sapiens gene LYZ

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)

LYZ MS Standard C13 and N15-labeled recombinant protein (NP_000230)

Tag C-Myc/DDK
Expression Host HEK293

3`UTR clone of lysozyme (renal amyloidosis) (LYZ) for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase

LYZ (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Anti-LYZ Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 19-148 amino acids of human lysozymelysozyme

Anti-LYZ Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 19-148 amino acids of human lysozymelysozyme

Lysozyme (LYZ) Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Lysozyme (Lysozyme (LYZ)) (NP_000230.1).
Modifications Unmodified

Lysozyme (LYZ) Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 19-148 of human Lysozyme (Lysozyme (LYZ)) (NP_000230.1).
Modifications Unmodified

Lysozyme Rabbit polyclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human Lysozyme

Lysozyme Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide of human Lysozyme

LYZ mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated