LYZ (Myc-DDK-tagged)-Human lysozyme (LYZ)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
LYZ (Myc-DDK-tagged)-Human lysozyme (LYZ)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human lysozyme (renal amyloidosis) (LYZ)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 820.00
3 Weeks
Lenti ORF particles, LYZ (Myc-DDK tagged) - Human lysozyme (LYZ), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, LYZ (mGFP-tagged) - Human lysozyme (LYZ), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
LYZ (GFP-tagged) - Human lysozyme (LYZ)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lyz1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Lenti ORF clone of Human lysozyme (LYZ), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, LYZ (Myc-DDK tagged) - Human lysozyme (LYZ), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human lysozyme (LYZ), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, LYZ (mGFP-tagged) - Human lysozyme (LYZ), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human lysozyme (LYZ), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
LYZ rabbit polyclonal antibody, Azide Free
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Immunogen | Highly purified lysozyme is isolated from pooled milk. Freund's complete adjuvant is used in the first step of the immunization procedure. |
Lysozyme C human protein, 1 mg
Protein Source | Neutrophils |
Rabbit monoclonal antibody against Lysozyme C(clone EPR2995)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
LYZ rabbit polyclonal antibody, Biotin
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
Immunogen | Highly purified lysozyme is isolated from pooled milk. Freund's complete adjuvant is used in the first step of the immunization procedure. |
LYZ rabbit polyclonal antibody, HRP
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
Immunogen | Highly purified lysozyme is isolated from pooled milk. Freund's complete adjuvant is used in the first step of the immunization procedure. |
LYZ rabbit polyclonal antibody, FITC
Applications | ELISA, IF, IHC |
Reactivities | Human |
Conjugation | FITC |
Immunogen | Highly purified lysozyme is isolated from pooled milk. Freund's complete adjuvant is used in the first step of the immunization procedure. |
LYZ HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Transient overexpression lysate of lysozyme (renal amyloidosis) (LYZ)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human lysozyme (LYZ), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lysozyme (LYZ) sheep polyclonal antibody, Aff - Purified
Applications | ELISA |
Reactivities | Human |
Immunogen | Human Lysozyme. |
Lysozyme (LYZ) sheep polyclonal antibody, Aff - Purified
Applications | ELISA |
Immunogen | Human Lysozyme. |
Lysozyme (LYZ) rabbit polyclonal antibody, Purified
Applications | IHC |
Reactivities | Canine, Feline, Human, Monkey, Porcine |
Immunogen | Human Lysozyme purified from the urine of patients with monocytic leukemia. |
LYZ rabbit polyclonal antibody, Serum
Applications | IP |
Reactivities | Human |
Immunogen | Highly purified lysozyme is isolated from pooled milk. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit Polyclonal Lysozyme Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-LYZ Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LYZ antibody: synthetic peptide directed towards the C terminal of human LYZ. Synthetic peptide located within the following region: HLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQYVQG |
Rabbit Polyclonal Anti-LYZ Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LYZ antibody: synthetic peptide directed towards the N terminal of human LYZ. Synthetic peptide located within the following region: CLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHL |
Rabbit anti Lysozyme Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Immunogen | A synthetic peptide corresponding to the C-terminus 115-129aa of chicken egg white Lysozyme protein. |
Carrier-free (BSA/glycerol-free) LYZ mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LYZ mouse monoclonal antibody, clone OTI1D8 (formerly 1D8)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LYZ mouse monoclonal antibody, clone OTI2C2 (formerly 2C2)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Human Lysozyme ELISA kit
Assay Type | Solid Phase Sandwich ELISA |
Format | 8x12 divisible strips |
Reactivities | Human |
LYZ CRISPRa kit - CRISPR gene activation of human lysozyme
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene LYZ
Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene LYZ
Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
LYZ MS Standard C13 and N15-labeled recombinant protein (NP_000230)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
3`UTR clone of lysozyme (renal amyloidosis) (LYZ) for miRNA target validation
Vector | pMirTarget |
Mammalian Cell Selection | Neomycin |
Species | Human |
Transfection Reporter | RFP |
Assay Reporter | Luciferase |
LYZ (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Anti-LYZ Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 19-148 amino acids of human lysozymelysozyme |
Anti-LYZ Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 19-148 amino acids of human lysozymelysozyme |
Lysozyme (LYZ) Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Lysozyme (Lysozyme (LYZ)) (NP_000230.1). |
Modifications | Unmodified |
Lysozyme (LYZ) Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 19-148 of human Lysozyme (Lysozyme (LYZ)) (NP_000230.1). |
Modifications | Unmodified |
Lysozyme Rabbit polyclonal Antibody
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human Lysozyme |
Lysozyme Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human Lysozyme |
Lysozyme Rabbit monoclonal Antibody
Applications | IF, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
LYZ mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
5 Days
LYZ mouse monoclonal antibody,clone 1C9, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
5 Days
LYZ mouse monoclonal antibody,clone 1C9, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
LYZ mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |